CAZyme Information: MGYG000001713_04164

Basic Information

• Species: Vibrio furnissii
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Vibrionaceae; Vibrio; Vibrio furnissii
• CAZyme ID: MGYG000001713_04164
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase F

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
481	MGYG000001713_20|CGC1	54664.78	8.8354

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001713	4958658	Isolate	Japan	Asia

• Gene Location: Start: 12496; End: 13941 Strand: +

Full Sequence      

MRLLNMALFALAYCLGWPAHSLELSPLSAKPYTGDWPVLKDKGTLRVVVSADLGFYYVEG
GRPKGIGAELLYHFEQYLKKQSPYVHVQIIPVLRDELILSVERGFADLAVANLTITPHRL
QQVDFSAPLTKDLQEFVITSKAAAPISTLEQLSGRQIWLRESSSYWDSIQAVNATLRAMN
RPLVEVHFIDEALQDYELLEMVNAGHVAATVLDSHKAELWQHVMENIQVHSELPLRENGQ
IAWALRKESPKLKTLINQYLKTVKSGTLLGNVIYSKYIDDTRWLTKALNPQKLAKLAQLR
QIFTHYSNQYAFEDLMMAAQAFQESGLDQRKISPKGAIGIMQVLPTTAQDPNVNIPHIDQ
VDNNIHAGIKYMRFIKDRYFTDPHISPDDQVYFALAAYNAGPASINRMRRLAQKHGFNPN
VWFKHVEVITRRNIGKEPIRYVSNISRYYVVYKQLDALQRAKVENQSANLDEVTDNAPMA
P

Enzyme Prediction     

No EC number prediction in MGYG000001713_04164.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	316	453	2.6e-21	0.7925925925925926

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd01009	PBP2_YfhD_N	1.81e-63	43	277	1	221	The solute binding domain of YfhD proteins, a member of the type 2 periplasmic binding fold protein superfamily. This subfamily includes the solute binding domain YfhD_N. These domains are found in the YfhD proteins that are predicted to function as lytic transglycosylases that cleave the glycosidic bond between N-acetylmuramic acid and N-acetylglucosamin in peptidoglycan, while the YfhD_N domain might act as an auxiliary or regulatory subunit. In addition to periplasmic solute binding domain, they have an SLT domain, typically found in soluble lytic transglycosylases, and a C-terminal low complexity domain. The YfhD proteins might have been recruited to create localized cell wall openings required for transport of large substrates such as DNA. They belong to the PBP2 superfamily of periplasmic binding proteins that differ in size and ligand specificity, but have similar tertiary structures consisting of two globular subdomains connected by a flexible hinge. They have been shown to bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.
cd13403	MLTF-like	2.38e-62	303	454	1	161	membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
COG4623	MltF	4.95e-49	31	450	11	429	Membrane-bound lytic murein transglycosylase MltF [Cell wall/membrane/envelope biogenesis, Signal transduction mechanisms].
PRK10859	PRK10859	2.15e-48	40	481	40	473	membrane-bound lytic murein transglycosylase MltF.
cd13530	PBP2_peptides_like	1.80e-23	44	277	1	217	Peptide-binding protein and related homologs; type 2 periplasmic binding protein fold. This domain is found in solute binding proteins that serve as initial receptors in the ABC transport, signal transduction and channel gating. The PBP2 proteins share the same architecture as periplasmic binding proteins type 1, but have a different topology. They are typically comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. The majority of PBP2 proteins function in the uptake of small soluble substrates in eubacteria and archaea. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically-located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. Besides transport proteins, the family includes ionotropic glutamate receptors and unorthodox sensor proteins involved in signal transduction.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDC94210.1	0.0	6	481	1	476
ADT86198.1	0.0	1	481	1	481
QTG97312.1	0.0	6	481	1	476
QTG89961.1	0.0	6	481	1	476
QTH09343.1	5.99e-277	1	469	1	469

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5AA2_B	8.91e-21	39	449	48	459	Crystalstructure of MltF from Pseudomonas aeruginosa in complex with NAM-pentapeptide. [Pseudomonas aeruginosa BWHPSA013]
4OZ9_A	1.39e-20	39	449	7	418	Crystalstructure of MltF from Pseudomonas aeruginosa complexed with isoleucine [Pseudomonas aeruginosa PAO1]
4OYV_A	1.47e-20	39	449	14	425	Crystalstructure of MltF from Pseudomonas aeruginosa complexed with leucine [Pseudomonas aeruginosa PAO1]
4OWD_A	1.47e-20	39	449	14	425	Crystalstructure of MltF from Pseudomonas aeruginosa complexed with cysteine [Pseudomonas aeruginosa PAO1],4OXV_A Crystal structure of MltF from Pseudomonas aeruginosa complexed with valine [Pseudomonas aeruginosa PADK2_CF510],4P0G_A Crystal structure of MltF from Pseudomonas aeruginosa complexed with bulgecin and muropeptide [Pseudomonas aeruginosa PAO1],4P11_A Native crystal structure of MltF Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1]
5AA2_A	2.14e-20	39	462	48	477	Crystalstructure of MltF from Pseudomonas aeruginosa in complex with NAM-pentapeptide. [Pseudomonas aeruginosa BWHPSA013],5AA2_C Crystal structure of MltF from Pseudomonas aeruginosa in complex with NAM-pentapeptide. [Pseudomonas aeruginosa BWHPSA013]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A8ZWR8	6.21e-35	39	458	37	454	Membrane-bound lytic murein transglycosylase F OS=Desulfococcus oleovorans (strain DSM 6200 / JCM 39069 / Hxd3) OX=96561 GN=mltF PE=3 SV=2
Q4KHS7	2.55e-29	39	449	37	448	Membrane-bound lytic murein transglycosylase F OS=Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5) OX=220664 GN=mltF PE=3 SV=2
Q886W7	3.77e-27	39	481	37	485	Membrane-bound lytic murein transglycosylase F OS=Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000) OX=223283 GN=mltF PE=3 SV=2
A8FY01	4.38e-27	42	468	34	457	Membrane-bound lytic murein transglycosylase F OS=Shewanella sediminis (strain HAW-EB3) OX=425104 GN=mltF PE=3 SV=1
Q3KHL5	6.28e-27	22	481	22	485	Membrane-bound lytic murein transglycosylase F OS=Pseudomonas fluorescens (strain Pf0-1) OX=205922 GN=mltF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000281	0.999063	0.000172	0.000162	0.000150	0.000141

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001713_04164.