CAZyme Information: MGYG000001717_00199

Basic Information

• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Coriobacteriaceae; Collinsella
• CAZyme ID: MGYG000001717_00199
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
808		92466.33	5.0462

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001717	2084358	MAG	Sweden	Europe

• Gene Location: Start: 61856; End: 64282 Strand: -

Full Sequence      

MRVETTGVCRGNWKIYQQLKIEGIHKGSSVTAQAATDDNRCLPLSLLKFRDNSCDSNSYV
LVVPDPDARTIKIEFSEIGQDGRTQSSESLSLNCKNIKWESRLNYKIKPDMCSKLRNYDD
VSEFDMATIDFWQCIEDSSDYILRCTVRTPYRSDSQIKIRCLDRALNEVNLNIVDFGSNV
TCVGFTSEKKQLETQLSIRMPKAFDRYYFVIDDQKHPSFCAFDCLTPDKLGLLLEETNFL
FTHAQFDPEYPEWFTEHKATIGALEKQRKIVFNSAPKFSIIVPLYNTPIPFFNDMAESVK
NQSYTNWELILVNASPDNRELKARVEQETAHDNRIKSINLTENKGISENTNAGVAIASGD
FVCFFDHDDIIEPDLLFSYAEAIENNDDVDLLYCDEDKLMPDGKLAQPFFKPDFNIDLLR
NNNYICHMLTIRKSLLDALEPNTKEFDGAQDHNLTLRAVEKARKVHHVAKVLYHWRLSET
STAANADSKPYATIAGIKAVQNHLDRLGLNAKVEQARRPFTYKVTYAVPDSHPLVSIIIP
TKDHADILDNCITSIVEKSTYDNYELVIIENNSTEKATFDYYDKLQAKYPDIVRLVTWEH
EFNFSKLMNFGVAHAKGNYLLLLNNDTEVITSNWIETMLGICAREDVGAVGAKLYYPDNT
IQHAGLCVTGGVAGHLCQSMPKDNWGYFALNDAQQDFSAVTAACIMTKRSEYEKVGGFTE
ELQVAFNDVDFCLKLREINDLIVYTPEVELYHHESISRGVENNTEKQIRFHKEVAYMNYR
WAKYYVEGDPYMNPNFTVGEPANRYYHL

Enzyme Prediction     

No EC number prediction in MGYG000001717_00199.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	279	391	5.3e-21	0.6588235294117647
GT2	536	659	5e-20	0.7058823529411765

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04184	GT2_RfbC_Mx_like	2.06e-82	276	476	1	201	Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis. The rfbC gene encodes a predicted protein of 1,276 amino acids, which is required for O-antigen biosynthesis in Myxococcus xanthus. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.
cd04186	GT_2_like_c	1.02e-35	537	754	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	1.48e-25	533	791	3	253	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
PRK10073	PRK10073	7.54e-21	273	413	3	139	putative glycosyl transferase; Provisional
cd00761	Glyco_tranf_GTA_type	2.57e-20	280	394	1	113	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATP53720.1	0.0	1	808	16	823
AZH69456.1	0.0	1	808	16	823
QOY61387.1	0.0	1	808	1	809
ACV56016.1	0.0	15	808	1	794
ACV56006.1	3.54e-202	1	808	1	829

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HEA_A	2.18e-09	279	389	8	116	CgTstructure in hexamer [Streptococcus parasanguinis FW213],5HEA_B CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEA_C CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEC_A CgT structure in dimer [Streptococcus parasanguinis FW213],5HEC_B CgT structure in dimer [Streptococcus parasanguinis FW213]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P55465	7.62e-125	253	798	344	890	Uncharacterized protein y4gI OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=NGR_a03550 PE=4 SV=1
Q50864	3.74e-89	249	798	292	833	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1
P71057	5.09e-14	276	518	4	252	Putative glycosyltransferase EpsH OS=Bacillus subtilis (strain 168) OX=224308 GN=epsH PE=2 SV=1
Q58457	4.10e-12	276	477	8	213	Uncharacterized glycosyltransferase MJ1057 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ1057 PE=3 SV=2
P71054	1.05e-07	273	386	2	114	Putative glycosyltransferase EpsE OS=Bacillus subtilis (strain 168) OX=224308 GN=epsE PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000042	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001717_00199.