CAZyme Information: MGYG000001720_01281

Basic Information

• Species: Prevotella sp002350355
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp002350355
• CAZyme ID: MGYG000001720_01281
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase F

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
396	MGYG000001720_18|CGC2	45145.61	8.8636

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001720	3435079	MAG	Sweden	Europe

• Gene Location: Start: 52309; End: 53499 Strand: +

Full Sequence      

MKFMTTVRNIYIYACCLLAFLSACQQQSKKPEMTPWGTTIGEDSLPKENSLSLDDIQTNG
ELIMLTISGPETYYDYHGHGMGAQYLLCQKFADKLGVSLRVEICQDTTELVHRMQKGEGD
LAAVLLPKKWKNLLYAGTADPKSHTSWIVRKDGKDLAQALNNWYHPGMIEKIKREEQFLL
STASITRHVYAPMLNRAGGVISRYDHLFQQYAPLARWDWRLLAAQCYQESTFDPKAHSWA
GACGLMQIMPSTADHVGLPRENLYDPEANIACAAKYIQELSGFFNDVPASERIYFVLASY
NGGHFHVRDAMALAHRDGRDPRRWGDVEPYILKLSSPAYYTLPIVKHGYMRGSETVNYVR
RIRERWNQYRGVAKGGFSSGVSTVPERAKRRYKWHL

Enzyme Prediction     

No EC number prediction in MGYG000001720_01281.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	217	368	1.8e-28	0.8074074074074075

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd13403	MLTF-like	5.87e-75	208	370	1	160	membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
PRK10859	PRK10859	4.07e-54	4	363	1	444	membrane-bound lytic murein transglycosylase MltF.
COG4623	MltF	4.27e-51	46	371	11	433	Membrane-bound lytic murein transglycosylase MltF [Cell wall/membrane/envelope biogenesis, Signal transduction mechanisms].
pfam01464	SLT	1.45e-24	218	310	11	102	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
cd13401	Slt70-like	1.97e-24	204	362	6	142	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGB28026.1	6.71e-186	17	396	34	413
ALO48082.1	3.89e-182	17	396	11	391
VEH15587.1	5.20e-171	11	396	30	433
BCS86517.1	3.58e-168	20	396	2	390
QUB48180.1	1.38e-163	17	396	12	392

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4OZ9_A	3.06e-24	52	367	3	419	Crystalstructure of MltF from Pseudomonas aeruginosa complexed with isoleucine [Pseudomonas aeruginosa PAO1]
4OWD_A	3.27e-24	52	367	10	426	Crystalstructure of MltF from Pseudomonas aeruginosa complexed with cysteine [Pseudomonas aeruginosa PAO1],4OXV_A Crystal structure of MltF from Pseudomonas aeruginosa complexed with valine [Pseudomonas aeruginosa PADK2_CF510],4P0G_A Crystal structure of MltF from Pseudomonas aeruginosa complexed with bulgecin and muropeptide [Pseudomonas aeruginosa PAO1],4P11_A Native crystal structure of MltF Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1]
4OYV_A	3.27e-24	201	367	263	426	Crystalstructure of MltF from Pseudomonas aeruginosa complexed with leucine [Pseudomonas aeruginosa PAO1]
5AA4_B	3.74e-24	201	367	249	412	Crystalstructure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013],5AA4_D Crystal structure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013]
5AA4_A	3.74e-24	201	367	249	412	Crystalstructure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013],5AA4_C Crystal structure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A0KJ50	4.52e-31	50	364	37	448	Membrane-bound lytic murein transglycosylase F OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049) OX=380703 GN=mltF PE=3 SV=1
Q0AQY9	1.77e-29	191	364	276	446	Membrane-bound lytic murein transglycosylase F OS=Maricaulis maris (strain MCS10) OX=394221 GN=mltF PE=3 SV=2
Q47XX8	2.05e-29	38	367	13	440	Membrane-bound lytic murein transglycosylase F OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) OX=167879 GN=mltF PE=3 SV=2
Q1C5E6	4.56e-29	109	363	186	444	Membrane-bound lytic murein transglycosylase F OS=Yersinia pestis bv. Antiqua (strain Antiqua) OX=360102 GN=mltF PE=3 SV=2
Q74SQ6	4.56e-29	109	363	186	444	Membrane-bound lytic murein transglycosylase F OS=Yersinia pestis OX=632 GN=mltF PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000001	0.000007	1.000022	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001720_01281.