CAZyme Information: MGYG000001720_01855

Basic Information

• Species: Prevotella sp002350355
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp002350355
• CAZyme ID: MGYG000001720_01855
• CAZy Family: GH127
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
820	MGYG000001720_34|CGC1	92157.61	8.1828

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001720	3435079	MAG	Sweden	Europe

• Gene Location: Start: 36284; End: 38746 Strand: +

Full Sequence      

MKRLLTFAATIVMLLPTQAQKRLGGYPITPVTFTSVKVAPNSFWGQRLEASRKVTIPLAF
SKCEETGRYKNFEHAAAHLKDPSKVFPVTGYSFDDTDPYKTIEGASYILQTYPDAKLKHY
IDSVITIIGSAQEPDGYLYTARTQNPQHPHEWAGDKRWSKEEDLSHELYNLGHMVEAAIA
HYQATGSRHFLDIAIRYADCVCREVGPKPGQACVVPGHQIAEMALCKLYLVTGQRKYLDE
AKFFLDYRGKTQGRSEYSQSHKPVVDQDEAVGHAVRAAYMYAGMADVAALTGDTAYIHAI
DRIWDNIVSKKLYITGGIGATNNGEAFGANYELPNMSAYAETCAAIGNVYVNYRLFLLHG
ESKYYDVLERTLYNGLISGVSLDGGKFFYPNPLESMGQHQRQPWFGCACCPSNICRFIPS
LPGYVYAVKDRNLYVNLFLANSATMKVGGKEVKLSQETQYPWNGDIALKIEDNRAGRFNM
KIRIPGWAKSRPVPSDLYEYSDGKRPSYSVLVNGKKAEADLEADGYYTINRTWKKGDIVR
IHFDMDVRTVRANNKVVADRGLIAVERGPLVYCAEWPDNNFDIMGMLVNQSPTFAAGEKP
MAAFIPTDRQKQLTLFKTQNITTLSTDAQLLAYDKQGRLTTTDERLTLIPYFAWCHRGSG
NMKVWMPQDVRATRPATPATLASQATIASSTPSASMKSIADGLVPADENDRSVPYFHWWP
KQGTTEWITYTFTEPQQVQSATIYWYDDQPWGGCKVPQSWNIEYQNAQGQWQPVADADSY
PVKKGQPCTVHFTPVKTKVLRLNVKQPEKYSCGLFEWSVK

Enzyme Prediction     

No EC number prediction in MGYG000001720_01855.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH127	41	573	1.1e-205	0.9904580152671756

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	0.0	35	573	1	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	5.73e-168	30	669	11	588	Uncharacterized conserved protein, DUF1680 family [Function unknown].
pfam17132	Glyco_hydro_106	2.21e-05	668	809	153	289	alpha-L-rhamnosidase.
COG1331	YyaL	0.002	224	372	419	564	Uncharacterized conserved protein YyaL, SSP411 family, contains thoiredoxin and six-hairpin glycosidase-like domains [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS84571.1	0.0	2	820	3	822
AGB29922.1	0.0	9	820	6	816
ADE82616.1	0.0	1	820	1	811
AII66185.1	0.0	1	820	1	801
QJR57394.1	0.0	1	820	1	801

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6EX6_A	0.0	25	673	4	630	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]
4QJY_A	1.32e-133	37	666	11	645	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	1.02e-128	37	666	11	645	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
3WRE_A	1.18e-105	74	665	52	655	Thecrystal structure of native HypBA1 from Bifidobacterium longum JCM 1217 [Bifidobacterium longum subsp. longum JCM 1217],3WRG_A The complex structure of HypBA1 with L-arabinose [Bifidobacterium longum subsp. longum JCM 1217]
3WKW_A	1.58e-105	74	665	52	655	Crystalstructure of GH127 beta-L-arabinofuranosidase HypBA1 from Bifidobacterium longum ligand free form [Bifidobacterium longum subsp. longum JCM 1217],3WKX_A Crystal structure of GH127 beta-L-arabinofuranosidase HypBA1 from Bifidobacterium longum arabinose complex form [Bifidobacterium longum subsp. longum JCM 1217],7BZL_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7DIF_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7EXV_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7EXW_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
E8MGH8	6.47e-105	74	665	52	655	Non-reducing end beta-L-arabinofuranosidase OS=Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b) OX=565042 GN=hypBA1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000399	0.998847	0.000245	0.000171	0.000158	0.000151

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001720_01855.