CAZyme Information: MGYG000001720_01972

Basic Information

• Species: Prevotella sp002350355
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp002350355
• CAZyme ID: MGYG000001720_01972
• CAZy Family: GH98
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
997	MGYG000001720_38|CGC1	110917.18	6.8643

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001720	3435079	MAG	Sweden	Europe

• Gene Location: Start: 20374; End: 23367 Strand: -

Full Sequence      

MKTILRNLLLLCLLALSLSVSGQQRRPIDSRHPLWLIHVDVWNKANPQAIIDMIPKDIRP
FVCMNLSLSCSYDTEKNVYKMPQNGVATYKSWATVCQQNGMWFTCQPASGGHTHIQDTDL
DTFEYFFKHYPNFLGWNYAEQFWGFDEKGDKSSSTQESRIALFAKLVEMSHKYGGFLTIS
FCGNIWSHALSPVGMLKRNADLLAACEKYPEAILWLYKYTTTSCFYNTESVTWGPYIAGL
ANNYGVRYDNCGWNGALEVMLGKDNGKKYPVAAGLSTVMEQSCVNGGAVWDGPELIWTED
IKNLDNTKVNGYTHRNWGFFPGFQNVWVDMFRKIIDGSLYIPTRQEVLGKTKIVVVNDIN
TGNIENQYGGWNDLYDGLYKQDDPMNKGNGYFMDNLTWFKKTGRYGAIPIVPELHDNLAK
AIPLQIKKSAKWSSQRDKLKDFNAQYPVVSTGDLYVNRYRNQLITYTPYSYFNKKRTATA
TIPLQYNTCKELQLTWGMLTAAAVREYADHINFYLNNYRVDTIAPVTDKIVVKGATAKPS
YTYTVGTETIPATVAGNQPQATLSDTWDAATGTYTLLVSHCGSVNIKLSCQGNATGRSTD
YLPDTSLERPKQPEAYAGPVTIEAEDIDYRSIQECCLSPYNVHPDERGNAGNGYIIMGTS
KNGSLRHVFNANVGGNYRVTLRYMNTDKKGNLKLNVNGTEKKVGCAVTGNNNWSTVSLGF
QFDKGANTLTIDNISGTNLCLDQVVYEPTTEQVKDDVAFEDEPDEPITPSDPAYPYVVLK
DNFAQEGGGKVPQGWVMADGDKIVSPGTYGSGPRIFQFPEGSTFTYGLYVRTPSSNDGYG
IYGTMPGYQVPLKSSAKYCLGLDAVAWKDTPYLKVEVLDENNTVIKSTIVPCKPNLEGST
TNVFTGATHVSLGFTVPKDGNYLFRFSPVLNEDGDGGYWREAMIGNIVLTSDTPSTGIRN
LLFDARNAGKTYDLSGRQVSGKATGVIIKDGHKYISK

Enzyme Prediction     

EC	3.2.1.8

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH98	23	339	2.1e-86	0.9877675840978594

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam08306	Glyco_hydro_98M	3.77e-91	23	339	6	328	Glycosyl hydrolase family 98. This domain is the putative catalytic domain of glycosyl hydrolase family 98 proteins.
pfam08307	Glyco_hydro_98C	1.96e-12	344	524	1	173	Glycosyl hydrolase family 98 C-terminal domain. This putative domain is found at the C-terminus of glycosyl hydrolase family 98 proteins. This domain is not expected to form part of the catalytic activity.
cd04083	CBM35_Lmo2446-like	2.51e-07	642	746	16	125	Carbohydrate Binding Module 35 (CBM35) domains similar to Lmo2446. This family includes carbohydrate binding module 35 (CBM35) domains that are appended to several carbohydrate binding enzymes. Some CBM35 domains belonging to this family are appended to glycoside hydrolase (GH) family domains, including glycoside hydrolase family 31 (GH31), for example the CBM35 domain of Lmo2446, an uncharacterized protein from Listeria monocytogenes EGD-e. These CBM35s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. GH31 has a wide range of hydrolytic activities such as alpha-glucosidase, alpha-xylosidase, 6-alpha-glucosyltransferase, or alpha-1,4-glucan lyase, cleaving a terminal carbohydrate moiety from a substrate that may be a starch or a glycoprotein. Most characterized GH31 enzymes are alpha-glucosidases.
cd04081	CBM35_galactosidase-like	5.10e-07	648	736	25	115	Carbohydrate Binding Module family 35 (CBM35); appended mainly to enzymes that bind alpha-D-galactose (CBM35-Gal), including glycoside hydrolase (GH) families GH27 and GH43. This family includes carbohydrate binding module family 35 (CBM35); these are non-catalytic carbohydrate binding domains that are appended mainly to enzymes that bind alpha-D-galactose (CBM35-Gal), including glycoside hydrolase (GH) families GH27 and GH43. Examples of proteins which contain CBM35s belonging to this family includes the CBM35 of an exo-beta-1,3-galactanase from Phanerochaete chrysosporium 9 (Pc1,3Gal43A) which is appended to a GH43 domain, and the CBM35 domain of two bifunctional proteins with beta-L-arabinopyranosidase/alpha-D-galactopyranosidase activities from Fusarium oxysporum 12S, Foap1 and Foap2 (Fo/AP1 and Fo/AP2), that are appended to GH27 domains. CBM35s are unique in that they display conserved specificity through extensive sequence similarity but divergent function through their appended catalytic modules. They are known to bind alpha-D-galactose (Gal), mannan (Man), xylan, glucuronic acid (GlcA), a beta-polymer of mannose, and possibly glucans, forming four subfamilies based on general ligand specificities (galacto, urono, manno, and gluco configurations). Some CBM35s bind their ligands in a calcium-dependent manner. In contrast to most CBMs that are generally rigid proteins, CBM35 undergoes significant conformational change upon ligand binding. GH43 includes beta-xylosidases and beta-xylanases, using aryl-glycosides as substrates, while family GH27 includes alpha-galactosidases, alpha-N-acetylgalactosaminidases, and isomaltodextranases.
cd04086	CBM35_mannanase-like	4.66e-06	620	733	1	106	Carbohydrate Binding Module 35 (CBM35); appended to several carbohydrate binding enzymes, including several glycoside hydrolase (GH) family 26 mannanase domains. This family includes carbohydrate binding module 35 (CBM35) domains that are appended to several carbohydrate binding enzymes, including periplasmic component of ABC-type sugar transport system involved in carbohydrate transport and metabolism, and several glycoside hydrolase (GH) domains, including GH26. These CBM6s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. Examples of proteins having CMB35s belonging to this family are mannanase A from Clostridium thermocellum (GH26), Man26B from Paenibacillus sp. BME-14 (GH26), and the multifunctional Cel44C-Man26A from Paenibacillus polymyxa GS01 (which has two GH domains, GH44 and GH26). GH26 mainly includes mannan endo-1,4-beta-mannosidase which hydrolyzes 1,4-beta-D-linkages in mannans, galacto-mannans, glucomannans, and galactoglucomannans, but displays little activity towards other plant cell wall polysaccharides. A few proteins belonging to this family have additional CBM3 domains; these CBM3s are not found in the CBM6-CBM35-CBM36_like superfamily.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGB29515.1	0.0	9	960	7	1006
AJQ96076.1	5.07e-168	34	745	1	694
AOZ99817.1	1.80e-162	20	732	28	725
AXY74108.1	1.09e-159	2	748	10	750
BAV06735.1	2.34e-157	11	699	18	695

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2WMG_A	3.76e-16	164	588	164	581	Crystalstructure of the catalytic module of a family 98 glycoside hydrolase from Streptococcus pneumoniae TIGR4 (Sp4GH98) in complex with the LewisY pentasaccharide blood group antigen. [Streptococcus pneumoniae TIGR4]
2WMH_A	1.51e-15	164	588	164	581	Crystalstructure of the catalytic module of a family 98 glycoside hydrolase from Streptococcus pneumoniae TIGR4 in complex with the H- disaccharide blood group antigen. [Streptococcus pneumoniae TIGR4]
2WMF_A	6.03e-15	164	588	164	581	Crystalstructure of the catalytic module of a family 98 glycoside hydrolase from Streptococcus pneumoniae TIGR4 (Sp4GH98) in its native form. [Streptococcus pneumoniae TIGR4]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000210	0.999205	0.000146	0.000143	0.000130	0.000122

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001720_01972.