CAZyme Information: MGYG000001720_02395

Basic Information

• Species: Prevotella sp002350355
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp002350355
• CAZyme ID: MGYG000001720_02395
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
455	MGYG000001720_58|CGC1	52145.49	4.4798

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001720	3435079	MAG	Sweden	Europe

• Gene Location: Start: 856; End: 2223 Strand: -

Full Sequence      

MPIVPMLTNNYGDAFRPEGIGRIMSDKHLRKQFLNTLVTICHRNRFQGINIDLEELAIND
NALLTNFVKELSMLFHDNDMYVTQDIAPFNEDYDVEPLARYNDYLFLMAYDEHNSESQPG
AIASQHWVERATDWAAKNIPNDKLVLGLAAYGYDWAQGDKGQTVSYDQTIASALDAGAQI
LFDDDSYNLSFSYDDDDGLLHQVHFTDAATLYNIMRFGVTYHLAGFGLWRLGTEDHRLWN
FYGKDLAWEQVKRWNMNRVLRLSGYDDVNFVGTGEVLDVESEPKPGKITVQIDPDDQIIT
EERYQCLPSTYTISKLCHCGAKDLLLTFDDGPDARWTPTVLRTLKRYHAPAAFFMVGLQM
EKNLPLVKKVYEDGFTIGNHTFTHHNMIENSDDRTYAELKLTRMLLESVIGQSTILFRAP
YNADADPTQHEEIEPMILASRRNYLFVGEEIDPDD

Enzyme Prediction     

No EC number prediction in MGYG000001720_02395.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	22	234	1.4e-33	0.7027027027027027
CE4	320	422	1.2e-26	0.7769230769230769

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd10962	CE4_GT2-like	1.12e-65	322	455	1	134	Catalytic NodB homology domain of uncharacterized bacterial glycosyl transferase, group 2-like family proteins. This family includes many uncharacterized bacterial proteins containing an N-terminal GH18 (glycosyl hydrolase, family 18) domain, a middle NodB-like homology domain, and a C-terminal GT2-like (glycosyl transferase group 2) domain. Although their biological function is unknown, members in this family contain a middle NodB homology domain that is similar to the catalytic domain of Streptococcus pneumoniae polysaccharide deacetylase PgdA (SpPgdA), an extracellular metal-dependent polysaccharide deacetylase with de-N-acetylase activity toward a hexamer of chitooligosaccharide N-acetylglucosamine, but not shorter chitooligosaccharides or a synthetic peptidoglycan tetrasaccharide. Like SpPgdA, this family is a member of the carbohydrate esterase 4 (CE4) superfamily. The presence of three domains suggests that members of this family may be multifunctional.
cd02874	GH18_CFLE_spore_hydrolase	5.80e-58	2	240	60	311	Cortical fragment-lytic enzyme (CFLE) is a peptidoglycan hydrolase involved in bacterial endospore germination. CFLE is expressed as an inactive preprotein (called SleB) in the forespore compartment of sporulating cells. SleB translocates across the forespore inner membrane and is deposited as a mature enzyme in the cortex layer of the spore. As part of a sensory mechanism capable of initiating germination, CFLE degrades a spore-specific peptidoglycan constituent called muramic-acid delta-lactam that comprises the outer cortex. CFLE has a C-terminal glycosyl hydrolase family 18 (GH18) catalytic domain as well as two N-terminal LysM peptidoglycan-binding domains. In addition to SleB, this family includes YaaH, YdhD, and YvbX from Bacillus subtilis.
cd06549	GH18_trifunctional	3.91e-55	2	239	61	298	GH18 domain of an uncharacterized family of bacterial proteins, which share a common three-domain architecture: an N-terminal glycosyl hydrolase family 18 (GH18) domain, a glycosyl transferase family 2 domain, and a C-terminal polysaccharide deacetylase domain.
COG3858	YaaH	7.29e-46	4	239	164	415	Spore germination protein YaaH [Cell cycle control, cell division, chromosome partitioning].
cd10917	CE4_NodB_like_6s_7s	4.00e-33	326	455	5	127	Catalytic NodB homology domain of rhizobial NodB-like proteins. This family belongs to the large and functionally diverse carbohydrate esterase 4 (CE4) superfamily, whose members show strong sequence similarity with some variability due to their distinct carbohydrate substrates. It includes many rhizobial NodB chitooligosaccharide N-deacetylase (EC 3.5.1.-)-like proteins, mainly from bacteria and eukaryotes, such as chitin deacetylases (EC 3.5.1.41), bacterial peptidoglycan N-acetylglucosamine deacetylases (EC 3.5.1.-), and acetylxylan esterases (EC 3.1.1.72), which catalyze the N- or O-deacetylation of substrates such as acetylated chitin, peptidoglycan, and acetylated xylan. All members of this family contain a catalytic NodB homology domain with the same overall topology and a deformed (beta/alpha)8 barrel fold with 6- or 7 strands. Their catalytic activity is dependent on the presence of a divalent cation, preferably cobalt or zinc, and they employ a conserved His-His-Asp zinc-binding triad closely associated with the conserved catalytic base (aspartic acid) and acid (histidine) to carry out acid/base catalysis. Several family members show diversity both in metal ion specificities and in the residues that coordinate the metal.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUB59098.1	2.12e-233	1	455	178	633
QUB57166.1	2.12e-233	1	455	178	633
QUB69936.1	3.38e-232	1	455	178	633
AUI56383.1	9.85e-232	1	455	178	633
QUB64534.1	1.35e-231	1	455	178	633

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5JH8_A	3.35e-26	11	247	64	315	Crystalstructure of chitinase from Chromobacterium violaceum ATCC 12472 [Chromobacterium violaceum ATCC 12472]
3CZ8_A	2.48e-23	7	235	73	312	ChainA, Putative sporulation-specific glycosylase ydhD [Bacillus subtilis subsp. subtilis str. 168],3CZ8_B Chain B, Putative sporulation-specific glycosylase ydhD [Bacillus subtilis subsp. subtilis str. 168]
5O6Y_A	5.10e-17	323	455	22	147	Crystalstructure of the Bc1960 peptidoglycan N-acetylglucosamine deacetylase in complex with 4-naphthalen-1-yl-~{N}-oxidanyl-benzamide [Bacillus cereus ATCC 14579]
5O6Y_B	5.98e-16	323	455	22	147	Crystalstructure of the Bc1960 peptidoglycan N-acetylglucosamine deacetylase in complex with 4-naphthalen-1-yl-~{N}-oxidanyl-benzamide [Bacillus cereus ATCC 14579],5O6Y_C Crystal structure of the Bc1960 peptidoglycan N-acetylglucosamine deacetylase in complex with 4-naphthalen-1-yl-~{N}-oxidanyl-benzamide [Bacillus cereus ATCC 14579],5O6Y_D Crystal structure of the Bc1960 peptidoglycan N-acetylglucosamine deacetylase in complex with 4-naphthalen-1-yl-~{N}-oxidanyl-benzamide [Bacillus cereus ATCC 14579]
2C1G_A	6.06e-16	322	426	236	340	Structureof Streptococcus pneumoniae peptidoglycan deacetylase (SpPgdA) [Streptococcus pneumoniae R6]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32258	4.15e-29	7	239	90	336	Uncharacterized glycosylase YvbX OS=Bacillus subtilis (strain 168) OX=224308 GN=yvbX PE=3 SV=1
O05495	7.84e-23	7	231	165	400	Putative sporulation-specific glycosylase YdhD OS=Bacillus subtilis (strain 168) OX=224308 GN=ydhD PE=1 SV=2
P37531	1.94e-20	3	239	166	416	Cortical fragment-lytic enzyme OS=Bacillus subtilis (strain 168) OX=224308 GN=sleL PE=1 SV=2
Q81EK9	7.94e-16	323	455	82	207	Peptidoglycan-N-acetylglucosamine deacetylase BC_1960 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711) OX=226900 GN=BC_1960 PE=1 SV=1
Q81AF4	2.36e-15	322	420	22	119	Peptidoglycan-N-acetylglucosamine deacetylase BC_3618 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711) OX=226900 GN=BC_3618 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000049	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001720_02395.