CAZyme Information: MGYG000001723_01767

Basic Information

• Species: UBA5446 sp004553625
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Oscillospiraceae; UBA5446; UBA5446 sp004553625
• CAZyme ID: MGYG000001723_01767
• CAZy Family: GH3
• CAZyme Description: Thermostable beta-glucosidase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
776	MGYG000001723_51|CGC1	83660.16	6.305

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001723	2328137	MAG	Sweden	Europe

• Gene Location: Start: 6948; End: 9278 Strand: -

Full Sequence      

MTDLELIRLCEGADCWHTRAVPELGLSPLMMADGPHGLRKQERAGDMLGMNRSKPATCFP
TAVLTACGWDAELMRCIGAAIAREALAEGVGLVLGPGANIKRSPLCGRNFEYFSEDPLLT
GVLAAAFIEGVQAEGAGACLKHFACNNQEYKRFSSDSTVDERTLREIYLRGFELAVKEAK
PAAVMCAYNSLNGEHCSDSRRLLTDILRSSWGFDGAVITDWGASNDRIRGFEAGCDLMMP
GGSGYMEEDCLRAMESGELSREAAAACAGRVIKLMKTYSGAASEGGACDYGRSHELARRA
AASCAVLMKNERGILPLKRRAGVVFIGDMAAHPRYQGSGSSHINPRKLTSAAGCCGDIAW
VQGCLADGSTRGDLISAAERAAGRAETAVVFAGLPPQYESEGFDRAGMSMPEGHIRLIEA
VAAANPNTVVVLFCGGAVELPWADKVRGILYMGLPGEAGGEAVEQLLFGLAVPSGKLAES
WPLRYSDCAVSEHYGERDPAYREGLYVGYRWYASAGIPVRYPFGHGLSYTSFEYSDIAVE
DGRVSFTLKNTGERAGAEVSQLYFTPPEGRYYRPQLNLCGFARTCLEPGESRRVSVDISR
ESLAVWTGVDWRVPGGVYRLKLGSSSEDIRLETELACPEVPLPAPPETPEWYFAPQGKPR
TADFERLLGRKLPERRSSKGAYTMESTLTDLCESSAPARAIRLVLEQVIARHCGGDRNSP
EYRMMFSSAADASLSGMQINGGIRGPWLRALQELANGKYISGLGKLLGGAAKAVKK

Enzyme Prediction     

EC	3.2.1.21	3.2.1.-	3.2.1.45

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	20	240	4.1e-68	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1472	BglX	1.02e-64	16	347	50	377	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PRK15098	PRK15098	6.86e-58	57	630	118	758	beta-glucosidase BglX.
PLN03080	PLN03080	1.50e-52	20	535	75	639	Probable beta-xylosidase; Provisional
pfam01915	Glyco_hydro_3_C	3.53e-51	305	529	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
pfam00933	Glyco_hydro_3	4.59e-38	28	274	67	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGC67350.1	9.77e-270	1	767	1	745
ANW97844.1	9.77e-270	1	767	1	745
AGI38411.1	9.77e-270	1	767	1	745
ANX00396.1	5.58e-269	1	767	1	745
AEF82048.1	3.45e-208	1	758	10	788

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7MS2_A	1.02e-196	1	632	12	663	ChainA, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	5.06e-145	5	629	16	655	CrystalStructure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	3.17e-115	18	632	43	708	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
2X42_A	4.74e-114	18	632	43	708	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]
3AC0_A	1.58e-97	5	629	17	828	Crystalstructure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P14002	5.60e-196	1	632	12	663	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2
E7CY69	1.00e-142	5	629	16	664	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium longum OX=216816 GN=apy PE=1 SV=1
F6C6C1	2.80e-142	5	629	16	664	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium breve (strain ACS-071-V-Sch8b) OX=866777 GN=HMPREF9228_1477 PE=1 SV=1
B8NDE2	1.75e-103	5	606	17	797	Probable beta-glucosidase I OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglI PE=3 SV=2
Q2U8Y5	3.41e-103	5	629	17	823	Probable beta-glucosidase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999902	0.000124	0.000006	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001723_01767.