CAZyme Information: MGYG000001724_00466

Basic Information

• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Coriobacteriaceae; Collinsella
• CAZyme ID: MGYG000001724_00466
• CAZy Family: GH77
• CAZyme Description: 4-alpha-glucanotransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
279	MGYG000001724_75|CGC1	31407.96	4.2501

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001724	1316907	MAG	Sweden	Europe

• Gene Location: Start: 82; End: 921 Strand: +

Full Sequence      

MWATPELFKIDAAGNPVSVAGTPPDQFSATGQYWGNPIYDWDAMESDGFSWWEGRIRAAL
DMYDVIRLDHFRGFEAYWEVPFSSPDSSYGSWTQGPGLKFFKTLEEKLGTLPIIAEDLGF
LTPGVIDMRDNSGFPGMKILQFAFEGTNSYYLPHNYIANTVAYVGTHDNETARGWFEGTA
TPRQREQAALYTHQQAGEPMADALNRTIAASVSDTCIYTMQDLLNLGNEARINTPATLGG
NWTWRMLDGAITRELEHKLTDWTETYFRIPSEAEIELPQ

Enzyme Prediction     

No EC number prediction in MGYG000001724_00466.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH77	1	264	2.2e-92	0.5425101214574899

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK14508	PRK14508	3.32e-141	2	269	230	497	4-alpha-glucanotransferase; Provisional
pfam02446	Glyco_hydro_77	4.76e-116	2	246	216	457	4-alpha-glucanotransferase. These enzymes EC:2.4.1.25 transfer a segment of a (1,4)-alpha-D-glucan to a new 4-position in an acceptor, which may be glucose or (1,4)-alpha-D-glucan.
PLN02635	PLN02635	3.01e-101	1	275	255	532	disproportionating enzyme
COG1640	MalQ	8.26e-85	1	274	241	520	4-alpha-glucanotransferase [Carbohydrate transport and metabolism].
TIGR00217	malQ	2.70e-68	2	268	244	513	4-alpha-glucanotransferase. This enzyme is known as amylomaltase and disproportionating enzyme. [Energy metabolism, Biosynthesis and degradation of polysaccharides]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIA34781.1	9.75e-211	1	279	223	501
ATP54274.1	2.79e-210	1	279	223	501
AZH70365.1	1.13e-209	1	279	223	501
AFA54836.1	2.92e-205	1	279	223	501
AKT47809.1	7.57e-143	1	278	222	500

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2OWC_A	1.44e-84	1	269	228	502	Structureof a covalent intermediate in Thermus thermophilus amylomaltase [Thermus thermophilus],2OWW_A Covalent intermediate in amylomaltase in complex with the acceptor analog 4-deoxyglucose [Thermus thermophilus],2OWX_A THERMUS THERMOPHILUS AMYLOMALTASE AT pH 5.6 [Thermus thermophilus]
2X1I_A	2.73e-84	1	269	225	500	glycosidehydrolase family 77 4-alpha-glucanotransferase from thermus brockianus [Thermus brockianus]
1CWY_A	7.67e-84	1	269	225	500	CrystalStructure Of Amylomaltase From Thermus Aquaticus, A Glycosyltransferase Catalysing The Production Of Large Cyclic Glucans [Thermus aquaticus],1ESW_A X-Ray Structure Of Acarbose Bound To Amylomaltase From Thermus Aquaticus. Implications For The Synthesis Of Large Cyclic Glucans [Thermus aquaticus]
1FP8_A	7.67e-84	1	269	225	500	StructureOf The Amylomaltase From Thermus Thermophilus Hb8 In Space Group P21212 [Thermus thermophilus],1FP9_A Structure Of Amylomaltase From Thermus Thermophilus Hb8 In Space Group C2 [Thermus thermophilus]
6M6T_A	2.04e-82	1	268	228	496	ChainA, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_B Chain B, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_C Chain C, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_D Chain D, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_E Chain E, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_F Chain F, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_G Chain G, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_H Chain H, 4-alpha-glucanotransferase [Streptococcus agalactiae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0A3Q1	1.72e-98	1	269	227	496	4-alpha-glucanotransferase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=malQ PE=3 SV=1
P0A3Q0	1.72e-98	1	269	227	496	4-alpha-glucanotransferase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=malQ PE=3 SV=1
Q59266	1.33e-93	1	268	216	485	4-alpha-glucanotransferase OS=Clostridium butyricum OX=1492 GN=malQ PE=1 SV=1
O87172	4.20e-83	1	269	225	500	4-alpha-glucanotransferase OS=Thermus thermophilus OX=274 GN=malQ PE=1 SV=1
Q9LV91	3.72e-75	1	269	305	576	4-alpha-glucanotransferase DPE1, chloroplastic/amyloplastic OS=Arabidopsis thaliana OX=3702 GN=DPE1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000061	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001724_00466.