CAZyme Information: MGYG000001724_00997

Basic Information

• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Coriobacteriaceae; Collinsella
• CAZyme ID: MGYG000001724_00997
• CAZy Family: GT51
• CAZyme Description: Penicillin-binding protein 1A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
191		21317.16	5.0355

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001724	1316907	MAG	Sweden	Europe

• Gene Location: Start: 8; End: 583 Strand: -

Full Sequence      

MGPRQRQGRSRSKTHALPIILLSFLGFLLIAGVAFGIGMVGNVNRWLSDLPDYTDANAYL
VSEPTEIVDCNGNKIASFYTQNRKSITKDEVSPYVLQGTVDVEDERFYEHGGIDLWGIAR
AAVATLGGGHEGASTITQQLVRNTILQEEQFDSTIERKVREAYIAVKMEDMYSKDEILMM
YLNTIYYGHGA

Enzyme Prediction     

No EC number prediction in MGYG000001724_00997.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	72	191	1.7e-42	0.6666666666666666

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00912	Transgly	2.31e-54	71	191	1	120	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
COG0744	MrcB	3.01e-45	19	191	14	184	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
COG5009	MrcA	1.60e-43	20	191	4	174	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
PRK11636	mrcA	2.14e-33	22	191	1	173	penicillin-binding protein 1a; Provisional
PRK13481	PRK13481	6.67e-27	94	188	56	148	glycosyltransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AZH69246.1	1.55e-127	1	191	1	191
QIA33680.1	1.71e-127	1	191	1	191
ATP53936.1	9.16e-127	1	191	1	191
QWT17307.1	2.71e-89	1	191	1	191
AEB07395.1	1.81e-87	1	191	1	191

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5U2G_A	8.92e-22	48	189	5	145	2.6Angstrom Resolution Crystal Structure of Penicillin-Binding Protein 1A from Haemophilus influenzae [Haemophilus influenzae Rd KW20],5U2G_B 2.6 Angstrom Resolution Crystal Structure of Penicillin-Binding Protein 1A from Haemophilus influenzae [Haemophilus influenzae Rd KW20]
2OQO_A	1.89e-20	69	191	6	127	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
3NB6_A	1.89e-20	69	191	6	127	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
7U4H_A	1.24e-19	60	188	16	142	ChainA, Penicillin-binding protein 1A (Pbp1a) [Chlamydia trachomatis D/UW-3/CX],7U4H_B Chain B, Penicillin-binding protein 1A (Pbp1a) [Chlamydia trachomatis D/UW-3/CX]
5ZZK_A	3.36e-19	81	188	54	160	ChainA, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus Mu50]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P38050	1.25e-29	11	191	5	174	Penicillin-binding protein 1F OS=Bacillus subtilis (strain 168) OX=224308 GN=pbpF PE=2 SV=2
P02918	7.33e-28	22	191	1	173	Penicillin-binding protein 1A OS=Escherichia coli (strain K12) OX=83333 GN=mrcA PE=1 SV=1
P39793	4.82e-25	3	191	20	202	Penicillin-binding protein 1A/1B OS=Bacillus subtilis (strain 168) OX=224308 GN=ponA PE=1 SV=1
Q9KNU5	5.57e-24	48	189	31	171	Penicillin-binding protein 1A OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) OX=243277 GN=mrcA PE=3 SV=2
O86088	4.78e-23	35	191	19	175	Penicillin-binding protein 1A OS=Neisseria cinerea OX=483 GN=mrcA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.989261	0.005915	0.000044	0.000039	0.000019	0.004733

TMHMM  Annotations     

start	end
19	41