CAZyme Information: MGYG000001724_01005

Basic Information

• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Coriobacteriaceae; Collinsella
• CAZyme ID: MGYG000001724_01005
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
344		38745.51	4.7451

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001724	1316907	MAG	Sweden	Europe

• Gene Location: Start: 1341; End: 2375 Strand: -

Full Sequence      

MLYHWRVHPGSTADGSADSKPYAIEAGRLALQRHFDSLGVCGTVEETETPFVYRMRYALP
EPAPLVSIVIPTKDHVETLDACVISIAENATYANYEIVLVENNSEDPKTFAYYEALPERI
AAASGGKGTARVEWWPGEFNYSQIINFGVEHAKGDYLLLLNNDTEVISPGFIEEMMGYLM
RPDAGVVGAKLYFADHLVQHAGILVGVRGALAHANQDFSAKREGYLARAVRPGNFSAVTG
ACQMVRRDVFEQVGGYNEEFAVGFNDADFCLRVREAGYRTIFTPYAELYHYEFTSRGREE
ANEEKLRRWKREQALFMQRWPEFFLDGDPWLGPNLSAESEYFSV

Enzyme Prediction     

No EC number prediction in MGYG000001724_01005.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	67	253	1e-20	0.9882352941176471

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04186	GT_2_like_c	1.20e-41	68	292	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	4.71e-34	64	317	3	248	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
COG1215	BcsA	1.50e-21	64	286	54	260	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
pfam00535	Glycos_transf_2	1.11e-20	67	250	1	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
pfam13641	Glyco_tranf_2_3	2.81e-16	64	292	2	213	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATP53737.1	4.15e-237	1	343	485	827
QIA33434.1	5.11e-233	1	344	485	828
AZH69434.1	9.55e-231	1	344	485	828
QOY61397.1	7.27e-149	1	344	461	801
ACV56006.1	1.23e-114	1	344	497	829

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P55465	2.44e-73	1	342	563	895	Uncharacterized protein y4gI OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=NGR_a03550 PE=4 SV=1
Q50864	3.80e-45	2	336	515	832	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1
P9WMY2	3.07e-10	90	302	28	247	N-acetylglucosaminyl-diphospho-decaprenol L-rhamnosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=wbbL PE=3 SV=2
P9WMY3	3.07e-10	90	302	28	247	N-acetylglucosaminyl-diphospho-decaprenol L-rhamnosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=wbbL PE=1 SV=2
P46370	1.83e-08	66	290	132	329	Uncharacterized 55.3 kDa protein in thcA 5'region OS=Rhodococcus erythropolis OX=1833 PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.997630	0.002252	0.000091	0.000015	0.000005	0.000034

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001724_01005.