CAZyme Information: MGYG000001725_00582

Basic Information

• Species: Massilimaliae sp900752435
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Massilimaliae; Massilimaliae sp900752435
• CAZyme ID: MGYG000001725_00582
• CAZy Family: GT5
• CAZyme Description: Glycogen synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
294	MGYG000001725_3|CGC2	33368.17	5.343

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001725	2564044	MAG	Sweden	Europe

• Gene Location: Start: 76211; End: 77095 Strand: +

Full Sequence      

MLGLNPYWFNCVHYDTCLNFMKSAIVLADKVTTVSRTYSYEIRHAYFAHGLQDILKEYGY
KVTGVVNGIDTDLYNAQKDTTIVNNFENGDLEGKAKNKLALQERLGLPVNKDIPMVGMIT
RLVAHKGLDLVEYVANDLMNLPIQFVVIGTGDERYQNLFYRLAWEHPDKMSANILFDPIL
ANQLYASADIFLMPSQSEPCGLSQLISMRYGTMPVVRETGGLYDTVPAFNPETGEGRGFT
FKSYNAHDMLGALNNALGVYYNKPLRQKLVDNIMNYDCSWKEPVQEYMNIYQSL

Enzyme Prediction     

No EC number prediction in MGYG000001725_00582.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT5	3	292	4.3e-102	0.6165254237288136

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03791	GT5_Glycogen_synthase_DULL1-like	7.18e-137	2	293	181	474	Glycogen synthase GlgA and similar proteins. This family is most closely related to the GT5 family of glycosyltransferases. Glycogen synthase (EC:2.4.1.21) catalyzes the formation and elongation of the alpha-1,4-glucose backbone using ADP-glucose, the second and key step of glycogen biosynthesis. This family includes starch synthases of plants, such as DULL1 in Zea mays and glycogen synthases of various organisms.
PRK00654	glgA	8.53e-136	2	294	170	463	glycogen synthase GlgA.
TIGR02095	glgA	2.12e-121	1	294	177	473	glycogen/starch synthase, ADP-glucose type. This family consists of glycogen (or starch) synthases that use ADP-glucose (EC 2.4.1.21), rather than UDP-glucose (EC 2.4.1.11) as in animals, as the glucose donor. This enzyme is found in bacteria and plants. Whether the name given is glycogen synthase or starch synthase depends on context, and therefore on substrate. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
COG0297	GlgA	2.05e-115	1	294	180	478	Glycogen synthase [Carbohydrate transport and metabolism].
PRK14099	PRK14099	2.16e-69	1	294	181	479	glycogen synthase GlgA.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJW45227.1	3.01e-97	2	294	183	476
QJW45205.1	3.01e-97	2	294	183	476
ACL69451.1	7.73e-96	1	294	183	478
AIQ74756.1	3.14e-95	1	294	179	472
AWV79379.1	4.84e-95	1	294	180	476

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4HLN_A	2.97e-61	2	292	316	623	Structureof barley starch synthase I in complex with maltooligosaccharide [Hordeum vulgare]
3D1J_A	1.12e-50	6	294	180	476	ChainA, Glycogen synthase [Escherichia coli]
2QZS_A	1.31e-50	6	294	180	476	CrystalStructure of Wild-type E.coli GS in complex with ADP and Glucose(wtGSb) [Escherichia coli],2R4T_A Crystal Structure of Wild-type E.coli GS in Complex with ADP and Glucose(wtGSc) [Escherichia coli],2R4U_A Crystal Structure of Wild-type E.coli GS in complex with ADP and Glucose(wtGSd) [Escherichia coli],3GUH_A Crystal Structure of Wild-type E.coli GS in complex with ADP and DGM [Escherichia coli K-12]
3COP_A	9.79e-50	6	294	180	476	ChainA, Glycogen synthase [Escherichia coli],3CX4_A Chain A, Glycogen synthase [Escherichia coli]
6GNE_A	1.58e-47	18	291	213	494	Catalyticdomain of Starch Synthase IV from Arabidopsis thaliana bound to ADP and acarbose [Arabidopsis thaliana],6GNE_B Catalytic domain of Starch Synthase IV from Arabidopsis thaliana bound to ADP and acarbose [Arabidopsis thaliana]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q97GX6	9.68e-96	1	294	180	476	Glycogen synthase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) OX=272562 GN=glgA PE=3 SV=1
A0PY73	2.31e-94	13	294	195	475	Glycogen synthase OS=Clostridium novyi (strain NT) OX=386415 GN=glgA PE=3 SV=1
A6TSC8	8.34e-88	12	294	192	474	Glycogen synthase OS=Alkaliphilus metalliredigens (strain QYMF) OX=293826 GN=glgA PE=3 SV=1
Q8XPA1	1.13e-86	18	294	204	480	Glycogen synthase OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=glgA PE=3 SV=1
Q72YJ6	1.36e-86	18	294	198	474	Glycogen synthase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) OX=222523 GN=glgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000070	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001725_00582.