CAZyme Information: MGYG000001725_01179

Basic Information

• Species: Massilimaliae sp900752435
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Massilimaliae; Massilimaliae sp900752435
• CAZyme ID: MGYG000001725_01179
• CAZy Family: GH2
• CAZyme Description: Exo-beta-D-glucosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
810	MGYG000001725_8|CGC2	93304.34	4.4651

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001725	2564044	MAG	Sweden	Europe

• Gene Location: Start: 66002; End: 68434 Strand: +

Full Sequence      

MVQQKLQDGWQLQIVQTGETMAAVVPGSVYGDLLRNGRMENPFWRDNEDAALRLMDNDFL
YTAQFDVCPEVLECEQVLLRCEGLDTVAQLTLNGEALGEVCNQHRTWEFDVRELLRPAGN
ELRILFHSPTRYIKEQYAKVKADGSEECSVGFPLLRKAHCMFGWDWGPRLPDAGIWRDIL
LLGINEARIDSVYITQHHHDGRVELEFDVQADVCCEDAEISYAVTLTAPDGTETAEMDSP
ACMTVERPQLWWPNGYGEQPLYTVEVVLLADGEPVDVWKRRIGLRTVTMRIEPDEYGESF
AHEVNGVAIFGMGADYIPEDNLFGRITPERTRKLLEQCKAANFNAIRVWGGGYYPDDWFY
DICDELGLLVWQDMMFACAVYELTDEFEENIVQELIDNIKRLRHHASLGLWCGNNEMEMF
VDRGNWVNTPKQKADYIKMYEYIFPKVLKEYDPNTFYWPASPSSGGSFDCPNDENRGDVH
YWDVWHGNKPFSEYRKFFFRYASEFGFQSFPCEKTVESFTLPEDRNIFSYVMEKHQRNAS
ANGKIMNYLYQTYCYPTNFGTLLYASQMLQAEAVKYGVEHWRRNRGRCMGAIYWQLNDCW
PVASWASIDYYGRWKALHYYAKRFFAPVMLSCCEEGTMTQEPNVNAEMQDIEKSIRLNVA
NETMRERTGVVRWALRSADASVVQFGEESVCVPALCSVWLDKVCFPQADLHGQYVSFELE
MEGEVISSGTVLFCAPKHFSFLDPRLTVEVDGDELVVTAQAYAKGVELLNENEDWILEDN
YFDMNAGTRRVKILSGEAVGIHVRSVFDIR

Enzyme Prediction     

No EC number prediction in MGYG000001725_01179.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	4	675	1.4e-106	0.6529255319148937

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	1.99e-96	1	695	10	685	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10340	ebgA	1.37e-17	69	416	120	449	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam00703	Glyco_hydro_2	5.11e-12	187	285	1	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
PRK10150	PRK10150	9.23e-11	9	287	33	278	beta-D-glucuronidase; Provisional
pfam17786	Mannosidase_ig	1.96e-09	655	738	3	91	Mannosidase Ig/CBM-like domain. This domain corresponds to domain 4 in the structure of Bacteroides thetaiotaomicron beta-mannosidase, BtMan2A. This domain has an Ig-like fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEF82182.1	0.0	1	810	1	816
QJU13790.1	0.0	1	810	1	823
QQQ93614.1	0.0	1	810	1	823
ASU28856.1	0.0	1	810	1	823
ANU76049.1	0.0	1	810	1	823

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6BYE_A	2.78e-159	6	810	8	848	Crystalstructure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri in complex with mannose [Xanthomonas citri pv. citri str. 306],6BYE_B Crystal structure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri in complex with mannose [Xanthomonas citri pv. citri str. 306]
6BYC_A	2.85e-159	6	810	8	848	Crystalstructure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
6BYI_A	2.04e-158	6	810	6	846	Crystalstructure of the acid-base mutant (E477A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306],6BYI_B Crystal structure of the acid-base mutant (E477A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
6BYG_A	2.10e-158	6	810	8	848	Crystalstructure of the nucleophile mutant (E575A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306],6BYG_B Crystal structure of the nucleophile mutant (E575A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
2VJX_A	6.75e-144	6	806	11	834	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q0CCA0	1.30e-117	3	796	6	828	Beta-mannosidase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=mndB PE=3 SV=2
Q5B7W2	2.39e-111	3	635	6	663	Beta-mannosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=mndB PE=1 SV=2
Q2TXB7	4.78e-111	24	800	31	833	Beta-mannosidase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=mndB PE=3 SV=3
B8NW36	4.78e-111	24	800	31	833	Beta-mannosidase B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=mndB PE=3 SV=1
A1CGA8	1.87e-110	24	800	31	834	Beta-mannosidase B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=mndB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000042	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001725_01179.