CAZyme Information: MGYG000001725_02518

Basic Information

• Species: Massilimaliae sp900752435
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Massilimaliae; Massilimaliae sp900752435
• CAZyme ID: MGYG000001725_02518
• CAZy Family: GH120
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
642		71782.48	6.1552

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001725	2564044	MAG	Sweden	Europe

• Gene Location: Start: 4682; End: 6610 Strand: +

Full Sequence      

MIYHVAKSGADSNPGTNEKPFLSIGKAALTARPGDTVIVHKGVYREWVNPQGGGRSNIRR
ITYQAAEGEPVTIKGSERIQSWKKTKGTVWSAVLPNSFFGHYNPYLEKLQGDWLVYPIGR
SLHPGNVYLNGMSFYEAENFKELENPVVRTTVLDRATQEYVEVKNPEQTKYVWYATVDDS
HTTIYANFHEADPNKELVEINVRPCCFFPEKTGVNYITVRGFEMAHAASQWAPPTANQPG
LMGANWSKGWIIENNVIHDSKCSAISIGKEISTGDNFRTSRKDKPGYQYQLESVFAASKS
GWSKEKIGSHIIRNNVIYDCGQNAVVGHLGCVFSEIYNNTIYNIGIKREFFGHEIAGIKL
HAAIDVQIHHNHIHDCSLGIWLDWQAQGTRLSKNCLYQNTRDVFLEVNHGPYIVDHNILG
SKNALEICAQGGAFIRNLIAGKIISRKELDRATPYHAPHSTEITGYAMVYAGDDRMYQNL
FIGDQTDLPVGTHVYNGSTTSLEEYIDRIEAINQVTPGDLEIFETVEQPVSISHNVYFNG
AQAFERESDKLEMPDFDPEYSITEIEGQAYLNLTLPKEFDSFLSAVHTSASLGRVRIVDA
DFENPDGSAITFDSDYLDSPITGPATCGPIQRLHAGKNRIKL

Enzyme Prediction     

EC	3.2.1.37

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH120	309	399	3.4e-40	0.989010989010989

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13229	Beta_helix	3.52e-06	308	399	32	137	Right handed beta helix region. This region contains a parallel beta helix region that shares some similarity with Pectate lyases.
pfam07602	DUF1565	0.001	8	46	2	40	Protein of unknown function (DUF1565). These proteins share a region of homology in their N termini, and are found in several phylogenetically diverse bacteria and in the archaeon Methanosarcina acetivorans. Some of these proteins also contain characterized domains such as pfam00395 and pfam03422.
pfam13229	Beta_helix	0.004	308	418	9	110	Right handed beta helix region. This region contains a parallel beta helix region that shares some similarity with Pectate lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AQS55786.1	1.54e-317	3	642	5	656
AEF16317.1	3.17e-315	1	642	1	637
AFK85955.1	1.82e-314	1	642	1	637
ABM68042.1	1.82e-314	1	642	1	637
ATZ76951.1	1.82e-314	1	642	1	637

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3VST_A	6.65e-316	1	642	1	637	Thecomplex structure of XylC with Tris [Thermoanaerobacterium saccharolyticum JW/SL-YS485],3VST_B The complex structure of XylC with Tris [Thermoanaerobacterium saccharolyticum JW/SL-YS485],3VST_C The complex structure of XylC with Tris [Thermoanaerobacterium saccharolyticum JW/SL-YS485],3VST_D The complex structure of XylC with Tris [Thermoanaerobacterium saccharolyticum JW/SL-YS485],3VSU_A The complex structure of XylC with xylobiose [Thermoanaerobacterium saccharolyticum JW/SL-YS485],3VSU_B The complex structure of XylC with xylobiose [Thermoanaerobacterium saccharolyticum JW/SL-YS485],3VSU_C The complex structure of XylC with xylobiose [Thermoanaerobacterium saccharolyticum JW/SL-YS485],3VSU_D The complex structure of XylC with xylobiose [Thermoanaerobacterium saccharolyticum JW/SL-YS485],3VSV_A The complex structure of XylC with xylose [Thermoanaerobacterium saccharolyticum JW/SL-YS485],3VSV_B The complex structure of XylC with xylose [Thermoanaerobacterium saccharolyticum JW/SL-YS485],3VSV_C The complex structure of XylC with xylose [Thermoanaerobacterium saccharolyticum JW/SL-YS485],3VSV_D The complex structure of XylC with xylose [Thermoanaerobacterium saccharolyticum JW/SL-YS485]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000039	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001725_02518.