CAZyme Information: MGYG000001728_00368

Basic Information

• Species: UBA1390 sp002305315
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; UBA1390; UBA1390; UBA1390 sp002305315
• CAZyme ID: MGYG000001728_00368
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
447		51106.8	4.3895

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001728	2194259	MAG	Sweden	Europe

• Gene Location: Start: 2550; End: 3893 Strand: -

Full Sequence      

MPTKPYVVQKGDSLFQIGRRLGVVPEGIYLFNRLTSDELQIGQILQIPSYVEAQTVREDV
PVYRWENTEGEIWGRVHAGTRFEVMDTTEQFFQVMYLRKIGYLNRKDAQILVYDHQVPVI
SVLGYYTEAEGERFPSSEKTFMENTDVLTQTALFFWRLDPGSPVLIENFADAAPGYVENL
VWEGHRNNVRMQGVIHNLMYNVPEESAQTVEIALANPERRQALVESILDLVRAYHLDGIN
LDLEDLYPKDQRLLNIFLELLHGELHEIGADLTVCLPPKMEEEEGEFDYAAIGNIADTVV
IMMYNEHGWPGSGPGPVSSSTWMRRVLEGVLPVIPAQKILAAVGLFGFDFNLTTEMVQYL
SYMQAQERMKYYRAQAEYDPVAQSWKFTYTDENGDQHEVWYDDGSSIVERAKIADEYGIQ
GLALWRLGLGDPQSWQDLRTQVAVRKG

Enzyme Prediction     

No EC number prediction in MGYG000001728_00368.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	212	428	1.9e-33	0.6959459459459459

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd02874	GH18_CFLE_spore_hydrolase	2.14e-87	119	438	1	313	Cortical fragment-lytic enzyme (CFLE) is a peptidoglycan hydrolase involved in bacterial endospore germination. CFLE is expressed as an inactive preprotein (called SleB) in the forespore compartment of sporulating cells. SleB translocates across the forespore inner membrane and is deposited as a mature enzyme in the cortex layer of the spore. As part of a sensory mechanism capable of initiating germination, CFLE degrades a spore-specific peptidoglycan constituent called muramic-acid delta-lactam that comprises the outer cortex. CFLE has a C-terminal glycosyl hydrolase family 18 (GH18) catalytic domain as well as two N-terminal LysM peptidoglycan-binding domains. In addition to SleB, this family includes YaaH, YdhD, and YvbX from Bacillus subtilis.
COG3858	YaaH	1.42e-62	6	441	4	421	Spore germination protein YaaH [Cell cycle control, cell division, chromosome partitioning].
cd06549	GH18_trifunctional	2.81e-43	184	435	56	298	GH18 domain of an uncharacterized family of bacterial proteins, which share a common three-domain architecture: an N-terminal glycosyl hydrolase family 18 (GH18) domain, a glycosyl transferase family 2 domain, and a C-terminal polysaccharide deacetylase domain.
pfam00704	Glyco_hydro_18	3.65e-17	213	428	82	305	Glycosyl hydrolases family 18.
cd02876	GH18_SI-CLP	5.33e-16	206	430	79	310	Stabilin-1 interacting chitinase-like protein (SI-CLP) is a eukaryotic chitinase-like protein of unknown function that interacts with the endocytic/sorting transmembrane receptor stabilin-1 and is secreted from the lysosome. SI-CLP has a glycosyl hydrolase family 18 (GH18) domain but lacks a chitin-binding domain. The catalytic amino acids of the GH18 domain are not conserved in SI-CLP, similar to the chitolectins YKL-39, YKL-40, and YM1/2. Human SI-CLP is sorted to late endosomes and secretory lysosomes in alternatively activated macrophages.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QEK11632.1	1.05e-101	2	446	5	457
AEV67249.1	1.75e-99	6	446	54	502
ALS24302.1	2.01e-98	6	446	4	501
AVQ50556.1	4.00e-98	2	445	5	502
APF25540.1	4.00e-98	2	445	5	502

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4S3J_A	8.35e-31	206	446	182	429	Crystalstructure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876],4S3J_B Crystal structure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876],4S3J_C Crystal structure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876]
3CZ8_A	2.23e-30	206	431	82	312	ChainA, Putative sporulation-specific glycosylase ydhD [Bacillus subtilis subsp. subtilis str. 168],3CZ8_B Chain B, Putative sporulation-specific glycosylase ydhD [Bacillus subtilis subsp. subtilis str. 168]
4S3K_A	6.99e-29	123	446	110	431	ChainA, Spore germination protein YaaH [Priestia megaterium QM B1551]
4Q6T_A	1.25e-20	224	440	102	337	Thecrystal structure of a class V chitininase from Pseudomonas fluorescens Pf-5 [Pseudomonas protegens Pf-5]
4WIW_A	6.25e-19	180	438	53	340	ChainA, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_B Chain B, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_C Chain C, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_D Chain D, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_E Chain E, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_F Chain F, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O05495	1.96e-34	6	446	4	419	Putative sporulation-specific glycosylase YdhD OS=Bacillus subtilis (strain 168) OX=224308 GN=ydhD PE=1 SV=2
P0DPJ9	4.39e-30	206	446	181	428	Cortical fragment-lytic enzyme OS=Bacillus anthracis OX=1392 GN=sleL PE=2 SV=1
Q9K3E4	1.55e-29	206	446	181	428	Cortical fragment-lytic enzyme OS=Bacillus cereus OX=1396 GN=sleL PE=1 SV=1
P37531	3.60e-28	188	446	163	427	Cortical fragment-lytic enzyme OS=Bacillus subtilis (strain 168) OX=224308 GN=sleL PE=1 SV=2
O32258	3.62e-25	186	447	82	342	Uncharacterized glycosylase YvbX OS=Bacillus subtilis (strain 168) OX=224308 GN=yvbX PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000053	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001728_00368.