CAZyme Information: MGYG000001728_01512

Basic Information

• Species: UBA1390 sp002305315
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; UBA1390; UBA1390; UBA1390 sp002305315
• CAZyme ID: MGYG000001728_01512
• CAZy Family: PL17
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
604		69761.05	6.0811

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001728	2194259	MAG	Sweden	Europe

• Gene Location: Start: 66; End: 1880 Strand: +

Full Sequence      

MEHFQDDPEVESGWGHAYFCSECGSFLEINPQDPHHHRCPHCGKIMEGPEYDGAWVYLYR
YDAVMSALGAAVLYRITREDEYLAYFQRVVGFYAENWYRFCEHGRHTWPSGNGKITPQAL
NEAIFLVKICTGLALLMEDLPTQFLEQVKAWFLLPCAYFLDVQKRRIHNIPCWINAAVGT
AGLMTGQEDLIQRAFSRPFGLSDQVRGGGVTASGFWYEGSIHYHFFTLEAFMNTLLFARF
YGQEIPQDVTERIYGMLIAPCQYAFSNGELPNPNDGWPNLNLKTYSFIYEMGARIFREDA
EKGRHLAALAARIRQLPIQRVAVPLSYPTYAGDVSLEWLLYAQEAEKTEMEKIPYFQRSY
VFEASQFATLKTKNVEVFYKFGHCTASHAHPDKMNVEIRAFGQRVSHDLSNCGYASKLCA
EFHRTSVSHNTVVMDGKNHPTTDPGQLLSFDGKEISARAMEAYPGIHFVRQLQLENDILR
DTFRIENPQKQWHTWDFFLHLDGRILDMPETEPGELGYRENGYAYLHNPRKMCTKEELCL
HWEFAGGVEGEQRLILRDKELWICESPDNPPSKEKKRVSLLIRSREEEPVFEQTWKFTQK
GVET

Enzyme Prediction     

No EC number prediction in MGYG000001728_01512.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL17	371	475	1.7e-21	0.920863309352518

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07940	Hepar_II_III	2.43e-08	362	439	9	90	Heparinase II/III-like protein. This family features sequences that are similar to a region of the Flavobacterium heparinum proteins heparinase II and heparinase III. The former is known to degrade heparin and heparin sulphate, whereas the latter predominantly degrades heparin sulphate. Both are secreted into the periplasmic space upon induction with heparin.
pfam16889	Hepar_II_III_N	0.001	210	289	249	336	Heparinase II/III N-terminus. This is the N-terminal domain of heparinase II/III proteins. It is a toroid-like domain.
pfam05426	Alginate_lyase	0.004	132	243	124	244	Alginate lyase. This family contains several bacterial alginate lyase proteins. Alginate is a family of 1-4-linked copolymers of beta -D-mannuronic acid (M) and alpha -L-guluronic acid (G). It is produced by brown algae and by some bacteria belonging to the genera Azotobacter and Pseudomonas. Alginate lyases catalyze the depolymerization of alginates by beta -elimination, generating a molecule containing 4-deoxy-L-erythro-hex-4-enepyranosyluronate at the nonreducing end. This family adopts an all alpha fold.
pfam12773	DZR	0.007	16	46	11	34	Double zinc ribbon. This family consists of a pair of zinc ribbon domains.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUI24665.1	4.30e-149	3	595	36	626
ADO83900.1	9.78e-132	2	595	34	626
ABX40876.1	1.09e-131	1	592	30	611
ADL02748.1	5.04e-123	1	584	33	617
QRV19036.1	5.04e-123	1	584	33	617

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4OK4_A	9.74e-15	61	526	93	581	CrystalStructure of Alg17c Mutant H202L [Saccharophagus degradans 2-40],4OK4_B Crystal Structure of Alg17c Mutant H202L [Saccharophagus degradans 2-40]
4NEI_A	3.90e-14	61	526	93	581	Alg17cPL17 Family Alginate Lyase [Saccharophagus degradans 2-40],4NEI_B Alg17c PL17 Family Alginate Lyase [Saccharophagus degradans 2-40]
4OJZ_A	1.18e-13	61	526	93	581	CrystalStructure of Alg17c Mutant Y258A Complexed with Alginate Trisaccharide [Saccharophagus degradans 2-40],4OJZ_B Crystal Structure of Alg17c Mutant Y258A Complexed with Alginate Trisaccharide [Saccharophagus degradans 2-40],4OK2_A Crystal Structure of Alg17c Mutant Y258A [Saccharophagus degradans 2-40],4OK2_B Crystal Structure of Alg17c Mutant Y258A [Saccharophagus degradans 2-40]
7BJT_A	1.58e-13	70	526	97	597	ChainA, Alginate lyase, family PL17 [Zobellia galactanivorans],7BJT_B Chain B, Alginate lyase, family PL17 [Zobellia galactanivorans]
7BM6_A	6.33e-13	70	526	97	597	ChainA, Alginate lyase, family PL17 [Zobellia galactanivorans],7BM6_B Chain B, Alginate lyase, family PL17 [Zobellia galactanivorans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q21FJ0	2.14e-13	61	526	93	581	Exo-oligoalginate lyase OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) OX=203122 GN=alg17C PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000062	0.000004	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001728_01512.