CAZyme Information: MGYG000001728_01554

Basic Information

• Species: UBA1390 sp002305315
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; UBA1390; UBA1390; UBA1390 sp002305315
• CAZyme ID: MGYG000001728_01554
• CAZy Family: GH142
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
697		81213.5	5.2679

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001728	2194259	MAG	Sweden	Europe

• Gene Location: Start: 733; End: 2826 Strand: +

Full Sequence      

MSYLEYEDRCLRTHTGKLLFGPVGRRLWVDYLDRKPGFCGRIDFIHKTNLTELFQVVCDR
EIDWELARSIWRPDWLSMKNSDRDVYMEETKSILFDDLAFSQQKWKNECDKPLTLTLQVA
PEGAEVDGMFFSTPELSYGYRVGGVCGWTLPGTTYVLEPGEQIEFVAACQVGNLSTETRE
ELEQKLDAFWKKYPHLEDALHAAEKEWQDFQDKVPTFYCSNPIVNAAWSYRWFIMRHCTA
YPAFGNLQHAVMYEGRSHRMNKTPFVSQGWEFTKLIPLSTPLHVTDYRWSEDHEIVREFL
RSFFDSADENGIPRCTVTNGYLASYANYGIWAVYQLYLLDGNQEFLREVLPAMKAYIAGH
IKVHGDAVDALQIEYTHSRTGKEYQPSYWYFHDYPKNPKDKSTYTPLKRVDRSVYHYLNT
KGLAAICRILQDPDQKKYEELAEKIAADINQKMWDQNTHFYYDLHYQTDEKAMVKNIVGF
YPYWAEISDDEKLPGLEYLKDPAHFNTGSAFPSVSKENPAYSPDGGWQGIFIKGRNGCVW
DGPSWPYTTGIALSALGRQSQLHGHKYDRDFWTFFRQYTAQHFRDGVLERPYLVEHYNPE
SGEPLSDEVDYNHSYWIDLVMSFVAGIHVEEDKIIVDPLQLGLQWFTMRNVLIRGHRYAV
SWAEKENIDAVPVGMKIMRDGETIFESDVIEKVEIVG

Enzyme Prediction     

No EC number prediction in MGYG000001728_01554.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH142	204	691	7.5e-54	0.9624217118997912

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10137	PRK10137	2.46e-15	410	529	578	709	alpha-glucosidase; Provisional
pfam17389	Bac_rhamnosid6H	1.05e-07	212	463	1	223	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
COG3408	GDB1	2.72e-05	330	575	345	562	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
pfam06202	GDE_C	4.03e-04	330	471	90	228	Amylo-alpha-1,6-glucosidase. This family includes human glycogen branching enzyme AGL. This enzyme contains a number of distinct catalytic activities. It has been shown for the yeast homolog GDB1 that mutations in this region disrupt the enzymes Amylo-alpha-1,6-glucosidase (EC:3.2.1.33).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AFH63258.2	3.14e-207	4	687	5	699
AFC30936.1	2.24e-206	4	687	12	706
QNK60812.1	2.86e-206	9	688	10	693
QQR38309.1	1.39e-185	9	665	13	672
CCW34533.1	2.96e-45	165	687	351	867

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W7S_A	1.49e-07	410	602	551	734	Escherichiacoli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7S_B Escherichia coli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7T_A Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7T_B Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7U_A Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12],3W7U_B Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12]
3W7X_A	1.49e-07	410	602	551	734	Crystalstructure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],3W7X_B Crystal structure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],5CA3_A Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5CA3_B Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
6XUX_A	1.58e-07	410	602	100	283	ChainA, Nanobody,Glucosidase YgjK,Glucosidase YgjK,Nanobody [Escherichia coli K-12]
7PQQ_B	1.58e-07	410	602	100	283	ChainB, Anti-RON nanobody,Megabody 91,Glucosidase YgjK [Lama glama]
7Q6Z_B	1.59e-07	410	602	122	305	ChainB, Megabody 177 [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P94250	3.93e-13	331	525	119	296	Uncharacterized protein BB_0381 OS=Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31) OX=224326 GN=BB_0381 PE=4 SV=2
P42592	8.24e-07	410	602	574	757	Glucosidase YgjK OS=Escherichia coli (strain K12) OX=83333 GN=ygjK PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000041	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001728_01554.