CAZyme Information: MGYG000001732_00369

Basic Information

• Species: HGM11530 sp900751685
• Lineage: Bacteria; Firmicutes_A; Clostridia; Monoglobales_A; UBA1381; HGM11530; HGM11530 sp900751685
• CAZyme ID: MGYG000001732_00369
• CAZy Family: PL11
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1018		111989.1	4.2375

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001732	3073889	MAG	Sweden	Europe

• Gene Location: Start: 43365; End: 46421 Strand: +

Full Sequence      

MRKFITLLICCFILSGSIVTADTRKMETLDRGLVAMQSGQGIYITWRLLGTEDYNTPFQL
YRDGAQIATVSESTNYFDADGTLDSSYMIQAGQEVSGAVTPFTSQKNYFDLPLNRPENIT
VDGETYCYTVGDASTGDLDGDGVYEIVLRWDIADSSYVGRTVYLDAYKFDGTQLWRIDLG
QNISTSSSCPFTVYDFNGDGIAEVCTKTAPGSTDGTGRFVSEASSNAAIQATDNSVNYAR
NSFGYVMEGPEYYTVFDGRNGRAMDTVSYPVPRGTDAKNTLSSVWGDNYHHRCDKFNEAA
AYLSGSTPSLILWRGIYFGQKAVGTGRTGICALDLNKENRLVITGRFDTMPGAAGYTFKN
EQYTGQGNHNMSVGDMDGDGKDEFVSGGLAMDHDLTPLWCSYRGHGDALHMGDYDPTHPG
LEYFSVHESGDTTAYNGTPLDYGMTLYYAEDGTEVFHTGSNRDTGRGMMANMGCGGYYQL
SGSSGVGTYSFDGSTFDKLSKDHLDAVNFRIFWNGDLYDDFLDSDNPYSILTPVIYSYQQ
DGLTEIFRADDTTTVNGTKSNPCLQADLFGDWREEFAVPLEDQTALRIFTTDIPTGHRLY
TLMHDSMYRSAISWQNASYNQPPHIGYYISETEDGYDQRSEKPDISCTRLSAPEISVTAR
PVPSAPPVPEPSYTPVPSYFTPVYQEDYENGYTEPAAGTTKWGWASPYHIDNLKMMSSGL
FSEIGRYLHFNSSASAGSYRSASMKLPDTLENNAMGFLSFDIQMTNSTTAVNQFALLGSN
ATLPDRALYSGEDYILLFDQPTDSQNWILNDPAIESTSGSTGEMTKNYWSNRWAHVEAWL
DFTKKEVQLNITNRSDGLEMYSGTVKMGAKVEKPESILLNCSRSGTGAIALDNISLYQVG
EPPILPTPTALPSPAPSASPAEPVEVKNVSIEQQDALWIISLTLCNYTPNEVKTVLPAFY
SGEQLTGVSPAQNLPPETALPLSISISSGALPEKLKLFFWDGYNSMLPIFPAMTIDLL

Enzyme Prediction     

No EC number prediction in MGYG000001732_00369.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL11	24	634	7.7e-178	0.9828473413379074

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd10318	RGL11	0.0	26	627	1	564	Rhamnogalacturonan lyase of the polysaccharide lyase family 11. The rhamnogalacturonan lyase of the polysaccharide lyase family 11 (RGL11) cleaves glycoside bonds in polygalacturonan as well as RG (rhamnogalacturonan) type-I through a beta-elimination reaction. Functionally characterized members of this family, YesW and YesX from Bacillus subtilis, cleave glycoside bonds between rhamnose and galacturonic acid residues in the RG-I region of plant cell wall pectin. YesW and YesX work synergistically, with YesW cleaving the glycoside bond of the RG chain endolytically, and YesX converting the resultant oligosaccharides through an exotype reaction. This domain is sometimes found in architectures with non-catalytic carbohydrate-binding modules (CBMs). There are two types of RG lyases, which both cleave the alpha-1,4 bonds of the RG-I main chain through a beta-elimination reaction, but belong to two structurally unrelated polysaccharide lyase (PL) families, 4 and 11.
pfam18370	RGI_lyase	6.40e-30	24	101	1	85	Rhamnogalacturonan I lyases beta-sheet domain. This is the beta-sheet domain found in rhamnogalacturonan (RG) lyases, which are responsible for an initial cleavage of the RG type I (RG-I) region of plant cell wall pectin. Polysaccharide lyase family 11 carrying this domain, such as YesW (EC:4.2.2.23) and YesX (EC:4.2.2.24), cleave glycoside bonds between rhamnose and galacturonic acid residues in RG-I through a beta-elimination reaction. Other family members carrying this domain are hemagglutinin A, lysine gingipain (Kgp) and Chitinase C (EC:3.2.1.14).
pfam13517	VCBS	0.005	137	204	1	59	Repeat domain in Vibrio, Colwellia, Bradyrhizobium and Shewanella. This domain of about 100 residues is found in multiple (up to 35) copies in long proteins from several species of Vibrio, Colwellia, Bradyrhizobium, and Shewanella (hence the name VCBS) and in smaller copy numbers in proteins from several other bacteria. The large protein size and repeat copy numbers, species distribution, and suggested activities of several member proteins suggests a role for this domain in adhesion (TIGR).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SNX53395.1	6.46e-152	24	631	43	612
AMA51412.1	3.54e-148	24	629	6	589
QDD05746.1	4.98e-148	24	629	6	589
QCY19435.1	4.98e-148	24	629	6	589
QCJ19410.1	4.98e-148	24	629	6	589

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2ZUY_A	5.43e-147	24	629	6	589	Crystalstructure of exotype rhamnogalacturonan lyase YesX [Bacillus subtilis]
4CAG_A	1.27e-143	21	645	6	587	Bacilluslicheniformis Rhamnogalacturonan Lyase PL11 [Bacillus licheniformis]
2Z8R_A	8.06e-139	24	631	3	570	Crystalstructure of rhamnogalacturonan lyase YesW at 1.40 A resolution [Bacillus subtilis],2Z8R_B Crystal structure of rhamnogalacturonan lyase YesW at 1.40 A resolution [Bacillus subtilis],2Z8S_A Crystal structure of rhamnogalacturonan lyase YesW complexed with digalacturonic acid [Bacillus subtilis],2Z8S_B Crystal structure of rhamnogalacturonan lyase YesW complexed with digalacturonic acid [Bacillus subtilis],2ZUX_A Crystal structure of rhamnogalacturonan lyase YesW complexed with rhamnose [Bacillus subtilis],2ZUX_B Crystal structure of rhamnogalacturonan lyase YesW complexed with rhamnose [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31527	2.32e-146	24	629	6	589	Rhamnogalacturonan exolyase YesX OS=Bacillus subtilis (strain 168) OX=224308 GN=yesX PE=1 SV=1
O31526	1.08e-137	24	631	40	607	Rhamnogalacturonan endolyase YesW OS=Bacillus subtilis (strain 168) OX=224308 GN=yesW PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000239	0.999108	0.000167	0.000161	0.000153	0.000135

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001732_00369.