CAZyme Information: MGYG000001732_00520

Basic Information

• Species: HGM11530 sp900751685
• Lineage: Bacteria; Firmicutes_A; Clostridia; Monoglobales_A; UBA1381; HGM11530; HGM11530 sp900751685
• CAZyme ID: MGYG000001732_00520
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1584		173651.57	4.4039

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001732	3073889	MAG	Sweden	Europe

• Gene Location: Start: 12103; End: 16857 Strand: +

Full Sequence      

MMNRFMKKIICMMTAAVLAVPVNIAWAKDINTAPQQPSGLLTNELERPLNVENSPYFNWL
PQDADQNEIQTAYQILVTDGITGAEVWDSGKVASSEQAYVKYAGSPLKDGYPYRWKVCTW
DREDEQSPYSQEAEFATGIGDYNWNAEWISANTSGSNNYWYARTEKETDANKKITKVLAY
ISCCHDYELNINGKRIGRGQSFDYTDVSQYQAWDITEAVADAPSIAVGITARWYGEGQGR
AKGKMGLLGRINVYYEDGSCDAITTDSTWKKSTTPFYGTAKRNAEGDFVEFYDAGKEIMG
WTERGFDDTSWGNVTSLGAHPVAPFDSVVAELGHVTEDEVKPVSVKTLSDGTTVADFGVV
IPARLSVHFKNGAAGKQVAIQTGYELKNDGKINTSTTSLQSTDMRFYYDQKEGEQTYNTW
DHLGFRYLQIPALEGETFTEEDITARIVHAEVPRGRDTTFKSSNETLNEVYELMKRSSIY
SAQNSFVDTPTREKGQFLNDSVNISNATMTTSYERTTTKKAIMQFLDSADRYWNSGNDLG
RYNAVYPNGDGKRDIPDFTINVPVWVWDYYTRTGDKDLLEYAYSYLRNTADYITRSIPET
GAAARLVTKLEGGSSSYEYGIVDWPAVGRYGYDWNGTKSGVRTTVNALSVRAFDTVAKIA
EELGKTEDAEIYQTRAERLKQAMNQTLITSNGVYCDGLDAEGNQVGNTAQHSTSYALAFD
IAPEDQKSNMAAYVAGMGMKQGPMTAHILVESMFKTGNGAAALDLLTDSKDNGWGRLVDQ
GYTFTWESWGNASTEAATDSQSHGWGAAAVTQIIDHIIGVGITEAGAKKIRIAPEPGLLD
SLESTVATERGPVKVAYSGERADYKLKVSVPVNVEAEVVLPVIGKGAFVESSGAAVNSSF
KDGKQVVVLGSGSYEFEYDGIATTKITIDNPEQIPSHAVIGGQNYTLPLEEEVDSNFLDS
IEIISDDANYRFAYVNGDILSANMPVLSRLQGDQVNLSAHFKYVAPAMDTAVLKITGEQG
KVRVNGMEYELPYEQSFANGQEVVVEPVAVEGMAFERWGNSSLLGSAPIIVMNGDVQTSI
LYQENGVKHLVSAGKAAAASDSLEREGTWGLARLTDGILEGTGYSSDATYANADVSDIKP
YVEIDLDQIQEINQVMLYPRTDAAAIAANKYMFPQDFYVEVSTDGSRYDRVADIVGAADS
ADPKIVNFEPVQARFVRVTFTKLCADPGSLGSRRLQLAEMEVYSGQTNAVLTEAVTLDKM
EEEIALGDTLEITASVQPASVDNKEVEWLLHEAGGGGFGGLSAKAEVKYSGNKATLIPFE
TGVVDLIARAKDGSGVLAKCRVTIASINNKITVNRVSVGESLLYDLGIQSKTGTLMTAVY
DDQNQLLDITYEDISGMQSLQKVVDITDEMTTGKIKFMLWDSVDAMVPLSTVTELKWDAS
KKDKVWELTKIVAVRTLMRDFGDDYVCNYDGLLIKGSNNDNDYIDPELGFRVNGKSPAGS
GAARYIAYTPEQDGTMEITAKREFTNASLSYSTSPELTNPVGIEGLSNNADWETGMIEMK
AGQTYYIHFTNSGMAIRSLRFVTK

Enzyme Prediction     

No EC number prediction in MGYG000001732_00520.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	345	880	2.3e-105	0.998015873015873
CBM67	146	324	8.2e-32	0.9886363636363636

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	1.84e-32	459	808	5	331	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	1.36e-19	172	311	1	147	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam00754	F5_F8_type_C	7.74e-14	1098	1222	1	114	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.
pfam17390	Bac_rhamnosid_C	7.78e-12	819	895	1	78	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam05592	Bac_rhamnosid	5.60e-09	346	449	1	102	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVT37928.1	2.58e-254	33	920	39	925
AVT31771.1	3.97e-253	33	920	39	925
ASO20813.1	6.12e-246	31	916	34	917
SCF06921.1	5.32e-245	33	916	44	925
APU21677.1	3.36e-243	18	916	22	918

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I60_A	1.21e-61	48	921	43	944	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
3W5M_A	1.47e-45	45	916	14	1028	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	2.00e-36	52	897	20	861	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]
2OKX_A	8.92e-14	396	881	476	942	Crystalstructure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1],2OKX_B Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q82PP4	7.68e-45	45	916	14	1028	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
P9WF03	2.40e-39	16	917	10	909	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
T2KPL4	6.79e-37	40	919	35	950	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1
T2KM26	5.23e-25	27	914	459	1174	Bifunctional sulfatase/alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22250 PE=1 SV=2
P33747	6.54e-07	1229	1416	20	174	Uncharacterized protein CA_P0160 OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) OX=272562 GN=CA_P0160 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000305	0.999008	0.000182	0.000167	0.000166	0.000148

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001732_00520.