CAZyme Information: MGYG000001732_01194

Basic Information

• Species: HGM11530 sp900751685
• Lineage: Bacteria; Firmicutes_A; Clostridia; Monoglobales_A; UBA1381; HGM11530; HGM11530 sp900751685
• CAZyme ID: MGYG000001732_01194
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1096		123753.21	5.2076

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001732	3073889	MAG	Sweden	Europe

• Gene Location: Start: 13341; End: 16631 Strand: +

Full Sequence      

MDTNILSGKSYYFHHDWSFLLADAFPLKKAIEKWRDPQGNCFYGLDYQEEGWEKVTLPHT
FNDSDLFRDRIKDAGSGQKRTVAFYRNWLDVPPGRKGQKVLLEFEGVRQTCYLYVNGALA
GYYEAGTAPFGFDITPWVDYERPNLIAIATDNTATRNINYCIAETPNKPDVEPGSYLFPQ
DEEVDPAYSGVGFFWNCNDFNPSLGGISRPVKVHFKPQIYLTLPLYSNLQTKGLYVYGID
YDIRKRQVKAGVKAELRNESGQAADVWIQVCIKDRKGNRIIQFSSERQKVMPASPISVPL
SIVPEDAYTEEILADGTKHYIPVQEEGKVEETATESVEVSVINAVSEKIQVRFWSIDDPY
LYTIEVQLFADGVVTDSAVIETGFRKAGYDKDQGVLINDRPVWLRGYAQRAANEWAGIGI
APEWLKDQDAMWIKESNANHIRWMHVAGSPADIRSFDRHGVVCTQPAGDKEQENFGRQWD
QRVELMRDIIIAFRNHPSILFWEAGNNSIGRAHMHEMRLLKEKLDPLGGRFMGCRTLNTE
DVVNESEYVGTMLNRHAARFTAEHGPVMETEYAREEAPRRVWDDFSPPDFDYKNKWLGLG
GRKQVGMDFYDLTSEELALTVARGYSEFFNDRIGGASGKDYYSGCAALCWTDSAQHGRQS
FSENGRMSGRVDAARNKKQNFDVFQVMQSPVDRIKILGHWNYPEQGGDHYQYHEKRFNGT
YWEETDKILYRDPKHKTVYVMGSYGIAKVVLKVNGRKVGVCEKPVHTFVFPFDNIDVTEH
GTAVAYGYDYDGNLVAEDELHTAGAPAQIMMAVHTAPDGLAADGNDVAYIDIRVVDKKGD
VCPLCYDKIDFSLEGAGLFLGGYNSGRFAGHGKDDSVIHASHIYAECGTNRVFIRSAKTA
GEIVVKAQMRGVPDAEVCFESHHVPLDRLTGKGQTPWYEDLTEMPGTIKTEFTPIPQADA
VKYTPEKQPYCKILVNGQEPDTRGVRSVNKNGSIWGAVLCILERMKQYGKDLFDYEYCPD
KKCLKIVSDDYTVEAEAGKTHLLVNGEENLMDGEPYVTPEGIFVMEVNAVVSYIKDVTAA
YDDKVGVFRIETNHLL

Enzyme Prediction     

No EC number prediction in MGYG000001732_01194.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	10	526	7e-63	0.47074468085106386

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	2.57e-19	16	533	18	432	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
pfam18565	Glyco_hydro2_C5	9.73e-17	820	917	10	102	Glycoside hydrolase family 2 C-terminal domain 5. Domain 5 is found in dimeric beta-D-galactosidase from Paracoccus sp. 32d, which contributes to stabilization of the functional dimer. It is suggested that the location of this domain 5, may be one of the factors responsible for the creation of a functional dimer and cold-adaptation of this enzyme.
PRK10150	PRK10150	1.11e-14	46	576	28	491	beta-D-glucuronidase; Provisional
PRK10340	ebgA	1.42e-11	85	508	113	450	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam00703	Glyco_hydro_2	1.23e-07	296	385	20	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGH35456.1	0.0	2	1095	11	1100
ASA20342.1	0.0	1	1091	1	1087
AGT88372.1	2.19e-183	16	915	8	785
ADJ49535.1	2.19e-183	16	915	8	785
QMV17606.1	4.88e-151	13	928	52	864

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6HPD_A	2.08e-126	10	948	37	841	Thestructure of a beta-glucuronidase from glycoside hydrolase family 2 [Formosa agariphila KMM 3901]
6ED1_A	6.26e-31	33	526	34	445	ChainA, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei],6ED1_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei],6ED1_C Chain C, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei],6ED1_D Chain D, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei]
7CWD_A	6.49e-30	13	917	6	797	ChainA, beta-glalactosidase [Niallia circulans],7CWI_A Chain A, beta-galactosidase [Niallia circulans]
4YPJ_A	3.38e-29	47	912	34	798	ChainA, Beta galactosidase [Niallia circulans],4YPJ_B Chain B, Beta galactosidase [Niallia circulans]
5T98_A	1.14e-23	32	859	32	762	Crystalstructure of BuGH2Awt [Bacteroides uniformis],5T98_B Crystal structure of BuGH2Awt [Bacteroides uniformis],5T99_A Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis],5T99_B Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KN75	9.28e-126	10	948	28	832	Beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22060 PE=1 SV=1
A7LXS9	1.06e-30	13	867	47	798	Beta-galactosidase BoGH2A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02645 PE=1 SV=1
Q56307	1.40e-13	16	525	45	459	Beta-galactosidase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=lacZ PE=1 SV=2
Q48846	1.49e-12	82	552	130	503	Beta-galactosidase large subunit OS=Latilactobacillus sakei OX=1599 GN=lacL PE=3 SV=1
Q02603	1.03e-11	47	525	97	484	Beta-galactosidase large subunit OS=Leuconostoc lactis OX=1246 GN=lacL PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000065	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001732_01194.