CAZyme Information: MGYG000001732_01816

Basic Information

• Species: HGM11530 sp900751685
• Lineage: Bacteria; Firmicutes_A; Clostridia; Monoglobales_A; UBA1381; HGM11530; HGM11530 sp900751685
• CAZyme ID: MGYG000001732_01816
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
362	MGYG000001732_59|CGC1	41979.89	5.8885

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001732	3073889	MAG	Sweden	Europe

• Gene Location: Start: 3105; End: 4193 Strand: -

Full Sequence      

MNSLEYAKAGAQTVMDKFKPEELPPNHRFHYHQGIFLTGVERLYKLTGDTRYRDYIKQWV
DFNIDENGNAPRCMITEFDDLQPAVLLFGLYAETGDERYRTMLERVHGVIEKWPVNAYGG
VWHKYQNKNQMWLDSMYMMGVITAMCANFFDNKYLFNKIHTQMVLMREHMTNPETGLLYH
MWDDSKEVGFVDQQTGCIQVHWGRAMGWYVAALAQILDLMPEDHPYRQDFIDTEIKYLTA
VKKYQDHNTGLWYQVLDRTEDQRNWFETSCTSLFTYAAVKLRNTGLIGDAFDAMIQAGYK
GVLSKTDLKGKTLEVAGVCVGTGVHYLDYYLERPTVTNDLHGMGAFLLMCTEVYKAFGSE
AM

Enzyme Prediction     

No EC number prediction in MGYG000001732_01816.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	23	355	1.9e-96	0.9789156626506024

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	1.92e-89	6	357	1	343	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	9.90e-89	1	357	6	357	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AZK46659.1	1.58e-112	4	356	11	363
QNF30158.1	1.08e-109	1	356	16	371
QNK55786.1	3.84e-108	6	356	13	363
AYV69577.1	5.33e-107	1	353	16	368
AYV72033.1	5.33e-107	1	353	16	368

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1NC5_A	7.90e-95	4	359	14	370	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	3.28e-94	4	359	4	360	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
4WU0_A	5.19e-58	5	352	3	357	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
3K11_A	2.49e-21	31	360	82	417	Crystalstructure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]
4XUV_A	1.40e-19	27	357	45	372	Crystalstructure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126],4XUV_B Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	4.32e-94	4	359	14	370	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P0A3U6	2.89e-16	170	352	32	227	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	2.89e-16	170	352	32	227	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1
L7P9J4	3.81e-08	5	355	34	375	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1
P9WF04	7.13e-06	33	353	94	408	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000078	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001732_01816.