CAZyme Information: MGYG000001732_02107

Basic Information

• Species: HGM11530 sp900751685
• Lineage: Bacteria; Firmicutes_A; Clostridia; Monoglobales_A; UBA1381; HGM11530; HGM11530 sp900751685
• CAZyme ID: MGYG000001732_02107
• CAZy Family: GH115
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1618		177289.64	4.4129

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001732	3073889	MAG	Sweden	Europe

• Gene Location: Start: 965; End: 5821 Strand: -

Full Sequence      

MFKKSIAAVISITMVLTLFAALTVSAETIENNAAVSAYVSMTNENGGLELVSPDKTPAIY
VDDKDFEGVRRAAGDLKEDINTITNKMPSITNDISLKETQAEEGISIDNGVMTVTIDSAP
IKDAQCFVASYDSAGALNAVKKSTNMIAANSGGKVFTFDNALQKPSGGKMKAFVWSDDME
PLKGVLGMKTAGTIELNGIDIVVGTLGMSTAVDALAQSSRIDISGIEGQWESFTIQNVDD
TFVIAGSDKRGTIYGIYDLCEKIGVSPWSFWADVVPGHADSLYINLPDGGYTEGEPSVQY
RGIFLNDEFNMSEWSKSMGNTGKNMNNATYEKLFELLLRLKANYLWPAMHTYSTAFNVTE
GNAALADQYGIVMGSSHAEPLLRNNLGELYDYQEAWKAKAENKGKALNTKTADGKSTIKD
DANRTVAYMWTDKDNDSNAVANKEFLTDYWRERAKANGNYENTYTLGMRGVHDGGFSTNM
DSQAAMKEILETQTQILKDEVVKEGQDISAVPQVFIPYKEMLDMYNKGLDIPDYVTLMWP
DDNFGYIRQLPTEKERERSGGAGIYYHLSYYGRPTSYLWLSTTQPGLIREEMTKAYDMGA
QKIWIANVGDLKPAETEIEYFLDLARDVDTMRNMDISGWLVENAKRDFGFDNEKAAEYAG
IKQGYYQNAAARRPEHFINGLFSTGFGDEGQKLIDGYAGLEQRAQALYNGLSEDQKPSFY
ELLLYPLKGAKNMAEKYVYSDKAKLYAEKGYGSAANKYAKLSDDAYQRVVDDTREYTAML
GGKWDKMMNPYQTRLTGSFGGTVTGKLDNPAVSELPYTNMEIVPEGGIDLSFTRYSTEPK
YVDIINTGTGSFEWTAETDAEWITMNKSNGTVADDDRIYISTDLSKAENGSNSAYITFTR
KLGNTDIQTFRVNVALENTAVSAAEEKTYIENDGFVSIEAEHYTRSITNGGYEWKVEKDF
GRSGDSVKIYPDTAKAVTTPNKNNSAYLEYDVYFTSAGTFPVDVYRMPALNEVSGSTMRC
NIGIDDNTPVRFSGNTKAKDKSDGTDVWGKGVLQNSDIVSGTITVPSAGLHTVRLYNESP
GVVVDKFVITTGEKKASYFGAPQSYNTTYNNQMKPLPAPSEASEEQTGSITALFEPQAMI
TNVTGTEVTVVKLAENESRDNLLLVAAYDKDGNMLGHSIISSFSQFENLGINESIHVPYQ
KPDLEGTVQLQYMILGPSPNYQISDRKPIAPAVTIDLPQAEDASFMASYDNGYAYPSVDM
QPYTARESVCYIAEYSDTLGETVKYIRQSTVREDTYKKIPFYHKGQYKLKISIAGVDDII
EEDLNTIINITPDNEATGESAIYDQPLDSDPASDNALTLNGASYDSAKKAVNMGAGGAVS
VDLDEPVTMAQGDTITTSFKIAHAKENGKFMDWAIKDSSGKSIAAVHVSAYNGTTTSHWM
SVGDEKVYENKGSLTQAILRTKDGEPGGYTTYTVTVNCATGAVAMTISSDNGTEGFAGKL
PDGTSYDIDRIEFSTDYTNALKSCLVKDILITKSKEASYNITFVPVDKSTRQPIENTVVT
VTDAVTGAVITPIDGKYALCQGNYSYTAVADGYTAGGGTLNLSPATESKEIIVEMEHN

Enzyme Prediction     

EC	3.2.1.131

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH115	184	796	7.1e-190	0.7776183644189383

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam15979	Glyco_hydro_115	3.95e-151	294	676	1	334	Glycosyl hydrolase family 115. Glyco_hydro_115 is a family of glycoside hydrolases likely to have the activity of xylan a-1,2-glucuronidase, EC:3.2.1.131, or a-(4-O-methyl)-glucuronidase EC:3.2.1.-.
pfam17829	GH115_C	2.36e-51	928	1102	1	171	Gylcosyl hydrolase family 115 C-terminal domain. This domain is found at the C-terminus of glycosyl hydrolase family 115 proteins. This domain has a beta-sandwich fold.
cd04079	CBM6_agarase-like	4.14e-04	936	1076	4	116	Carbohydrate Binding Module 6 (CBM6); appended mainly to glycoside hydrolase (GH) family 16 alpha- and beta agarases. This family includes carbohydrate binding module 6 (CBM6) domains that are appended mainly to glycoside hydrolase (GH) family 16 agarases. These CBM6s are non-catalytic carbohydrate binding domains that facilitate the activity of alpha- and beta-agarase catalytic modules which are involved in the hydrolysis of 1,4-beta-D-galactosidic linkages. These CBM6s bind specifically to the non-reducing end of agarose chains, recognizing only the first repeat of the disaccharide, and directing the appended catalytic modules to areas of the plant cell wall attacked by beta-agarases. CBM6 is an unusual CBM as it represents a chimera of two distinct binding sites with different modes of binding: binding site I within the loop regions and binding site II on the concave face of the beta-sandwich fold. This family includes three tandem CBM6s from the Saccharophagus degradans agarase Aga86E, and three tandem CBM6s from Vibrio sp. strain PO-303 AgaA; in both these proteins these are appended to a GH16 domain. Vibrio AgaA also contains a Big-2-like protein-protein interaction domain. This family also includes two tandem CBM6s from an endo-type beta-agarase from a deep-sea Microbulbifer-like isolate, which are appended to a GH16 domain, and two of three CBM6s of Alteromonas agarilytica AgaA alpha-agarase, which are appended to a GH96 domain.
pfam03648	Glyco_hydro_67N	0.002	201	259	64	120	Glycosyl hydrolase family 67 N-terminus. Alpha-glucuronidases, components of an ensemble of enzymes central to the recycling of photosynthetic biomass, remove the alpha-1,2 linked 4-O-methyl glucuronic acid from xylans. This family represents the N-terminal region of alpha-glucuronidase. The N-terminal domain forms a two-layer sandwich, each layer being formed by a beta sheet of five strands. A further two helices form part of the interface with the central, catalytic, module (pfam07488).
cd04080	CBM6_cellulase-like	0.005	938	1090	5	144	Carbohydrate Binding Module 6 (CBM6); appended to glycoside hydrolase (GH) domains, including GH5 (cellulase). This family includes carbohydrate binding module 6 (CBM6) domains that are appended to several glycoside hydrolase (GH) domains, including GH5 (cellulase) and GH16, as well as to coagulation factor 5/8 carbohydrate-binding domains. CBM6s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. The CBM6s are appended to GHs that display a diversity of substrate specificities. For some members of this family information is available about the specific substrates of the appended GH domains. It includes the CBM domains of various enzymes involved in cell wall degradation including, an extracellular beta-1,3-glucanase from Lysobacter enzymogenes encoded by the gluC gene (its catalytic domain belongs to the GH16 family), the tandem CBM domains of Pseudomonas sp. PE2 beta-1,3(4)-glucanase A (its catalytic domain also belongs to GH16), and a family 6 CBM from Cellvibrio mixtus Endoglucanase 5A (CmCBM6) which binds to the beta1,4-beta1,3-mixed linked glucans lichenan, and barley beta-glucan, cello-oligosaccharides, insoluble forms of cellulose, the beta1,3-glucan laminarin, and xylooligosaccharides, and the CBM6 of Fibrobacter succinogenes S85 XynD xylanase, appended to a GH10 domain, and Cellvibrio japonicas Cel5G appended to a GH5 (cellulase) domain. GH5 (cellulase) family includes enzymes with several known activities such as endoglucanase, beta-mannanase, and xylanase, which are involved in the degradation of cellulose and xylans. GH16 family includes enzymes with lichenase, xyloglucan endotransglycosylase (XET), and beta-agarase activities. CBM6 is an unusual CBM as it represents a chimera of two distinct binding sites with different modes of binding: binding site I within the loop regions and binding site II on the concave face of the beta-sandwich fold. For CmCBM6 it has been shown that these two binding sites have different ligand specificities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AFO77172.1	1.32e-208	178	1110	81	979
ADJ45460.1	1.32e-208	178	1110	81	979
AGT84300.1	1.32e-208	178	1110	81	979
AEK42229.1	1.32e-208	178	1110	81	979
QEV23754.1	1.07e-206	201	1110	84	959

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZMH_A	1.20e-123	201	1104	68	933	Crystalstructure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40],4ZMH_B Crystal structure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40]
6NPS_A	5.71e-101	201	1105	65	964	Crystalstructure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112],6NPS_B Crystal structure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112]
5BY3_A	8.13e-101	194	786	61	613	Anovel family GH115 4-O-Methyl-alpha-glucuronidase, BtGH115A, with specificity for decorated arabinogalactans [Bacteroides thetaiotaomicron VPI-5482]
7PXQ_A	2.00e-82	201	788	68	624	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]
7PUG_A	9.11e-82	201	788	69	625	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000288	0.998933	0.000208	0.000184	0.000176	0.000163

TMHMM  Annotations     

start	end
7	29