CAZyme Information: MGYG000001732_02302

Basic Information

• Species: HGM11530 sp900751685
• Lineage: Bacteria; Firmicutes_A; Clostridia; Monoglobales_A; UBA1381; HGM11530; HGM11530 sp900751685
• CAZyme ID: MGYG000001732_02302
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1154		127597.04	4.4148

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001732	3073889	MAG	Sweden	Europe

• Gene Location: Start: 52; End: 3516 Strand: +

Full Sequence      

MATVYFTAFTAFADDSSIGQPYVEPESPAVTYNMNLDWKFYDTKTDVEIWSAMAKADKDG
KKFYEKDYDDSDWGATSIPHGIGGGTNSFAATNPDAGGGYRSVLLYRKTFTVPQYEEGGK
VFFELEGIRQAAYVWVNGQKVGYYEAGITAMGFDISKYVKPGEEAVIAILNDGTTARGTS
GRIPYETVPGEEWGSSYTPDNYKTTVGDGSSFVWNTKDFNEPQIGLVYDAYLHVKGNVYQ
TLPLYNNLKTTGNYIYADNFDIKLKKATINVEAEIRNESSQDGNYTLEVAVVDADGNLKY
NFESSSTQVVKATDAGVTYETAVEDNVYNQENITNATGLTKVNTPDVTYIKASYDAEDMR
FWSTEDPYLYTVYTILKDSNGNAVDVQKKDTGFRKVTYDANSGIMLNDKAVWMPGYAQRA
TNEWAVIGVATDWLQDYDMSLIKENNANFIRWMHVAPKPYEVRSSDRYGVAVVCPAGDKE
GVGLTGRQWSQRTEAMRDAMIYFRNSPSVIFWETGNSSVGSAANANEMADLRDQIDPKGM
RFIGARSTTAADQLNYEYNYAGTMYGNYASNAISSMKQNGIMGPIMETEYARNESPRRVW
DLYSPPDYDYVNKFISKGGKLDGYDVWNQTQEETVISNIEEYDGYYSNRAGYGNSMYSAA
AMMVWSDSNMHTRNTATENDRTTGRVDAVRQKKEMFEGTKAAQSSEAAIHIVGHWSYPEL
TEDTYNYYGTKTVEIDSGHSYEDYDMNDKRKRDPLNKTVYAIGSSQVSKVELYRRDGETD
TLLGTCDSPTKTFIYSFKNIDITKGDAVIAKAYDARGTLIATDEIARTYDAVSLRLTPHT
AVKENEKGETITDWRADGSDIAYIDVEVIDKNGNVCALNYDKINFEYSGEGVYLGGYNSG
SGAGCFQNSSGSTGLSFYFGGAKDGVSTLGQDYVYAENGTNRIFVRSTRNAGSFTLKASM
DGMLPVSTTITSNAVETVGGLTTQMQSTRKPGASQIPPETSVESMKPLMLEKKTLDWDKV
KVETGAEEKEYYDVYINGTKFEAGSSTHIGLMNTLFGPVYPILQAVKAAGASGFEVEYSD
ASPATLTVTAGGHTYQYKENLNALITDGTDQTECVDMPVVKDGVMVANLELILSCAGVEF
TRDDNNSILNITVQ

Enzyme Prediction     

No EC number prediction in MGYG000001732_02302.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	29	651	4.1e-59	0.6170212765957447

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10340	ebgA	2.89e-21	63	537	63	468	cryptic beta-D-galactosidase subunit alpha; Reviewed
COG3250	LacZ	1.13e-20	94	554	74	442	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK09525	lacZ	1.97e-13	106	537	124	481	beta-galactosidase.
pfam18565	Glyco_hydro2_C5	4.07e-11	834	969	1	103	Glycoside hydrolase family 2 C-terminal domain 5. Domain 5 is found in dimeric beta-D-galactosidase from Paracoccus sp. 32d, which contributes to stabilization of the functional dimer. It is suggested that the location of this domain 5, may be one of the factors responsible for the creation of a functional dimer and cold-adaptation of this enzyme.
PRK10150	PRK10150	3.93e-09	106	537	69	441	beta-D-glucuronidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGH35456.1	8.49e-219	32	1134	19	1077
ASA20342.1	2.58e-217	32	1110	11	1045
QKJ29765.1	4.57e-151	13	985	23	887
AGT88372.1	1.02e-150	30	982	1	801
ADJ49535.1	1.02e-150	30	982	1	801

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6HPD_A	2.77e-110	27	985	33	817	Thestructure of a beta-glucuronidase from glycoside hydrolase family 2 [Formosa agariphila KMM 3901]
7CWD_A	1.50e-25	33	974	5	803	ChainA, beta-glalactosidase [Niallia circulans],7CWI_A Chain A, beta-galactosidase [Niallia circulans]
5T98_A	9.45e-24	33	893	29	762	Crystalstructure of BuGH2Awt [Bacteroides uniformis],5T98_B Crystal structure of BuGH2Awt [Bacteroides uniformis],5T99_A Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis],5T99_B Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis]
5DMY_A	6.46e-22	27	975	22	885	Beta-galactosidase- construct 33-930 [Bifidobacterium bifidum],5DMY_B Beta-galactosidase - construct 33-930 [Bifidobacterium bifidum],5DMY_C Beta-galactosidase - construct 33-930 [Bifidobacterium bifidum]
7NIT_A	1.90e-21	27	975	16	879	ChainA, Beta-galactosidase [Bifidobacterium bifidum],7NIT_B Chain B, Beta-galactosidase [Bifidobacterium bifidum],7NIT_C Chain C, Beta-galactosidase [Bifidobacterium bifidum],7NIT_D Chain D, Beta-galactosidase [Bifidobacterium bifidum],7NIT_E Chain E, Beta-galactosidase [Bifidobacterium bifidum],7NIT_F Chain F, Beta-galactosidase [Bifidobacterium bifidum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KN75	1.26e-109	27	985	24	808	Beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22060 PE=1 SV=1
A7LXS9	2.66e-19	27	901	40	798	Beta-galactosidase BoGH2A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02645 PE=1 SV=1
T2KM09	1.45e-15	58	724	60	642	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22050 PE=2 SV=2
O52847	5.65e-15	100	520	131	484	Beta-galactosidase OS=Priestia megaterium (strain DSM 319 / IMG 1521) OX=592022 GN=bgaM PE=3 SV=1
T2KPJ7	3.32e-14	30	537	32	462	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.257747	0.740978	0.000288	0.000448	0.000281	0.000248

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001732_02302.