CAZyme Information: MGYG000001735_00385

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides
• CAZyme ID: MGYG000001735_00385
• CAZy Family: GH35
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
826	MGYG000001735_3|CGC4	93926.67	6.2479

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001735	5309957	MAG	Sweden	Europe

• Gene Location: Start: 125152; End: 127632 Strand: +

Full Sequence      

MNTILMRTACLAFIFCVSNPFVQARENDSVKQEITGKQFTYPARIRYDGSCMTIDGKDIF
VYSAAFHYFRCPEELWRDRFRQIKEAGFNVVETYVPWNWHERSMPKSLNDTTNFDFSDLK
RWLKIAQEEFGLYTIVRPGPFICAEYSGGGYPRWLTRFRPEGVEGFWLRSADPEHIRWSV
HWFDAVCKALADEQVTRKPKGEKGIIMIQIENEYDAHDCDGKDKFLKELYRSVRRNGFDV
PVFTCLTRECRESEDTELSQVFDCDNYYVGLSAAPSCAHRMVALRRGQPDAPGFVTELQG
GWFSLVTGKLSEDHYSDNRHFKAIGLMSILGGATGINYYMFFGGTHFAGWGARGMTTTYD
YNAAIHENGMLGPKYYEAKGIGSFIKAFEPQLVRSEGGPCELEGGPKELFGGVRIAVDGT
RFIFLHNTDPDHPVKGKVTLIPGKLSKPAEPMYNINQNGEKVLISSEDIKDTDSLTVEPI
EVRYDLPALGCKVLVVPAGKKPSQGEWWPKEQMRPLRPSRLPDPVRITSVLKKEDDFSQA
KWQLLPQLVSLSDLDVNDFRYSLYRTHVNLTSQQAADERFLLFNMFTRDIVSVQVNGKQA
KRLFPDKADAQTWTTRNCFDRIRPDEYDNRFDVSGLLKEGKNEIIAVYENLGHAHGYVPM
EELAGIRQGGLSVTETAMTHPLEWECAKDAAGITAGWNLPQFTPQGWQSVALDTTCDIPC
KGNDIQPESDPDGLFTWYRIEFELPSVDPSVWIPWLLRINASGNGYMWLNGHNIGRHWEA
GPQREFYLPECWLNFGKKKNVLVLGLRQTVNGAIIKAMQVAPYPSI

Enzyme Prediction     

No EC number prediction in MGYG000001735_00385.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH35	53	381	9.8e-85	0.9837133550488599

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01301	Glyco_hydro_35	5.76e-77	52	379	2	312	Glycosyl hydrolases family 35.
PLN03059	PLN03059	2.23e-34	43	794	28	702	beta-galactosidase; Provisional
COG1874	GanA	1.19e-22	45	220	1	167	Beta-galactosidase GanA [Carbohydrate transport and metabolism].
pfam02449	Glyco_hydro_42	8.39e-11	72	235	8	167	Beta-galactosidase. This group of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. The enzyme catalyzes the hydrolysis of terminal, non-reducing terminal beta-D-galactosidase residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUI47871.1	0.0	37	823	35	822
QUU05629.1	0.0	37	823	35	822
ANQ59332.1	0.0	37	823	35	822
CUA17207.1	0.0	37	823	35	822
QQT29253.1	0.0	4	825	16	833

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6EON_A	1.32e-37	54	381	37	345	GalactanaseBT0290 [Bacteroides thetaiotaomicron VPI-5482]
4MAD_A	2.04e-37	43	381	16	335	ChainA, Beta-galactosidase [Niallia circulans],4MAD_B Chain B, Beta-galactosidase [Niallia circulans]
3D3A_A	5.74e-36	54	381	17	325	Crystalstructure of a beta-galactosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
3THC_A	1.95e-35	45	389	11	335	Crystalstructure of human beta-galactosidase in complex with galactose [Homo sapiens],3THC_B Crystal structure of human beta-galactosidase in complex with galactose [Homo sapiens],3THC_C Crystal structure of human beta-galactosidase in complex with galactose [Homo sapiens],3THC_D Crystal structure of human beta-galactosidase in complex with galactose [Homo sapiens],3THD_A Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens],3THD_B Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens],3THD_C Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens],3THD_D Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens]
3WEZ_A	2.31e-35	45	389	35	359	Crystalstructure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WEZ_B Crystal structure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WEZ_C Crystal structure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WEZ_D Crystal structure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WF0_A Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF0_B Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF0_C Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF0_D Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF1_A Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF1_B Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF1_C Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF1_D Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF2_A Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens],3WF2_B Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens],3WF2_C Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens],3WF2_D Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8RUV9	8.49e-36	45	785	31	670	Beta-galactosidase 1 OS=Oryza sativa subsp. japonica OX=39947 GN=Os01g0533400 PE=2 SV=1
O19015	8.87e-36	44	389	34	359	Beta-galactosidase OS=Felis catus OX=9685 GN=GLB1 PE=2 SV=1
Q5R7P4	9.40e-36	45	389	34	358	Beta-galactosidase OS=Pongo abelii OX=9601 GN=GLB1 PE=2 SV=1
Q9TRY9	4.98e-35	45	389	35	359	Beta-galactosidase OS=Canis lupus familiaris OX=9615 GN=GLB1 PE=1 SV=3
Q9SCV5	8.13e-35	34	780	17	663	Beta-galactosidase 7 OS=Arabidopsis thaliana OX=3702 GN=BGAL7 PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000305	0.998907	0.000272	0.000172	0.000158	0.000153

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001735_00385.