CAZyme Information: MGYG000001735_01150

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides
• CAZyme ID: MGYG000001735_01150
• CAZy Family: GH109
• CAZyme Description: Inositol 2-dehydrogenase/D-chiro-inositol 3-dehydrogenase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
461	MGYG000001735_9|CGC3	51131.02	7.4795

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001735	5309957	MAG	Sweden	Europe

• Gene Location: Start: 129124; End: 130509 Strand: -

Full Sequence      

MKKENSISRRSFLKSSAMAGALGAIGTGSAASVLTSCDGGSKANALKPLKEPGTYYVPEL
PDLAADGQELKAGVIGCGGRGSGAAFNFLNAANGVTIVALGDTFQERVDDLAGKLKKDKN
IDIPADKRFVGLDAYKQVIDSGVDVVIIATPPVFRPVHFQYATEKGKHSFLEKPICVDPV
GYRTIMATAKQADAKNLRVITGTQRHHQRPYVESYKKIMEGMIGEITGGTVYWNQNMLWF
RERQKDWNDCEYMIKDWVNWKWLSGDHIVEQHVHNIDVFTWFSGLKPVKAVGFGSRHRRV
TGDQYDNFSIDFTMENGIHMHSMCRQIDGCVNNVSEFIQGTKGSWDSSTMEIKDLAGNVV
WKYDFEAEKANFKQNDPYTLEHVNWINSIRGNKPLQQASETAISNMAAIMGRESAYTGAE
TTWDAMTASPLDYTPKDLNLGKMDMSSFTVPVPGKPLEQKK

Enzyme Prediction     

EC	3.2.1.18

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH109	68	249	6.7e-16	0.44110275689223055

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0673	MviM	4.09e-34	67	418	1	335	Predicted dehydrogenase [General function prediction only].
pfam01408	GFO_IDH_MocA	4.23e-11	70	202	1	119	Oxidoreductase family, NAD-binding Rossmann fold. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.
TIGR04380	myo_inos_iolG	1.23e-10	69	226	1	145	inositol 2-dehydrogenase. All members of the seed alignment for this model are known or predicted inositol 2-dehydrogenase sequences co-clustered with other enzymes for catabolism of myo-inositol or closely related compounds. Inositol 2-dehydrogenase catalyzes the first step in inositol catabolism. Members of this family may vary somewhat in their ranges of acceptable substrates and some may act on analogs to myo-inositol rather than myo-inositol per se. [Energy metabolism, Sugars]
pfam10518	TAT_signal	4.04e-05	6	31	1	26	TAT (twin-arginine translocation) pathway signal sequence.
TIGR01299	synapt_SV2	5.86e-04	281	319	467	506	synaptic vesicle protein SV2. This model describes a tightly conserved subfamily of the larger family of sugar (and other) transporters described by pfam00083. Members of this subfamily include closely related forms SV2A and SV2B of synaptic vesicle protein from vertebrates and a more distantly related homolog (below trusted cutoff) from Drosophila melanogaster. Members are predicted to have two sets of six transmembrane helices.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKH96209.1	0.0	1	460	1	460
BBK93797.1	1.10e-317	1	460	1	460
QIX65768.1	1.10e-317	1	460	1	460
QUT96603.1	1.10e-317	1	460	1	460
AST52349.1	1.10e-317	1	460	1	460

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CEA_A	9.97e-09	70	295	9	210	ChainA, Myo-inositol 2-dehydrogenase [Lactiplantibacillus plantarum WCFS1],3CEA_B Chain B, Myo-inositol 2-dehydrogenase [Lactiplantibacillus plantarum WCFS1],3CEA_C Chain C, Myo-inositol 2-dehydrogenase [Lactiplantibacillus plantarum WCFS1],3CEA_D Chain D, Myo-inositol 2-dehydrogenase [Lactiplantibacillus plantarum WCFS1]
3E18_A	9.70e-06	74	360	10	260	CRYSTALSTRUCTURE OF NAD-BINDING PROTEIN FROM Listeria innocua [Listeria innocua],3E18_B CRYSTAL STRUCTURE OF NAD-BINDING PROTEIN FROM Listeria innocua [Listeria innocua]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as TAT

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	0.000000	0.989101	0.010891	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001735_01150.