CAZyme Information: MGYG000001735_01190

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides
• CAZyme ID: MGYG000001735_01190
• CAZy Family: GH16
• CAZyme Description: Keratan-sulfate endo-1,4-beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
261	MGYG000001735_10|CGC1	29574.1	4.3134

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001735	5309957	MAG	Sweden	Europe

• Gene Location: Start: 52672; End: 53457 Strand: +

Full Sequence      

MKKGLSGLLTCFGAICVLSCTQQPKEWTLVWEDNFDQADGFDPASWSKIPRGGSDWNNYM
SDFDSCYAMRDGKLILRGLVNYSLPTDTAPFITGGVYTKDKVGFNNGRLEIHAKLNGATG
AWPAFWLLPQDGKWPNGGEIDIMERLNNDSIAYQTVHSNYTFNLGIKDNPKQGGTGLIDR
NDFNTYTVEMYPDSLVFFINDNHTFTYPRIETDKEGQYPFSDGQFYLLLDMQLGGSWVGA
VEPDDLPVEMEIDWVRFYQKQ

Enzyme Prediction     

No EC number prediction in MGYG000001735_01190.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	31	258	9.3e-52	0.9956521739130435

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd08023	GH16_laminarinase_like	5.10e-69	31	258	1	235	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
cd00413	Glyco_hydrolase_16	2.43e-27	33	258	1	210	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
cd02182	GH16_Strep_laminarinase_like	4.06e-21	27	259	2	259	Streptomyces laminarinase-like, member of glycosyl hydrolase family 16. Proteins similar to Streptomyces sioyaensis beta-1,3-glucanase (laminarinase) present in Actinomycetales as well as Peziomycotina. Laminarinases belong to glycosyl hydrolase family 16 and hydrolyze the glycosidic bond of the 1,3-beta-linked glucan, a major component of fungal and plant cell walls and the structural and storage polysaccharides (laminarin) of marine macro-algae. Members of the GH16 family have a conserved jelly roll fold with an active site channel.
COG2273	BglS	1.39e-17	25	258	39	263	Beta-glucanase, GH16 family [Carbohydrate transport and metabolism].
cd08024	GH16_CCF	4.19e-17	29	235	1	276	Coelomic cytolytic factor, member of glycosyl hydrolase family 16. Subgroup of glucanases of unknown function that are related to beta-GRP (beta-1,3-glucan recognition protein), but contain active site residues. Beta-GRPs are one group of pattern recognition receptors (PRRs), also referred to as biosensor proteins, that complexes with pathogen-associated beta-1,3-glucans and then transduces signals necessary for activation of an appropriate innate immune response. Beta-GRPs are present in insects and lack all catalytic residues. This subgroup contains related proteins that still contain the active site and are widely distributed in eukaryotes. Their structures adopt a jelly roll fold with a deep active site channel harboring the catalytic residues, like those of other glycosyl hydrolase family 16 members.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT49638.1	1.98e-151	1	261	1	261
QCQ43864.1	6.29e-139	10	261	5	263
QRM68917.1	6.29e-139	10	261	5	263
QLK81163.1	6.29e-139	10	261	5	263
QKH86000.1	1.47e-137	9	261	7	263

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6T2R_AAA	1.61e-105	18	259	21	262	ChainAAA, Beta-glycosidase [Bacteroides caccae]
4CRQ_A	8.00e-27	25	260	1	232	Crystalstructure of the catalytic domain of the modular laminarinase ZgLamC mutant E142S [Zobellia galactanivorans],4CRQ_B Crystal structure of the catalytic domain of the modular laminarinase ZgLamC mutant E142S [Zobellia galactanivorans],4CTE_A Crystal structure of the catalytic domain of the modular laminarinase ZgLamC mutant E142S in complex with a thio-oligosaccharide [Zobellia galactanivorans],4CTE_B Crystal structure of the catalytic domain of the modular laminarinase ZgLamC mutant E142S in complex with a thio-oligosaccharide [Zobellia galactanivorans]
6T2S_AAA	1.87e-26	28	256	1	236	ChainAAA, Glycoside hydrolase family 16 protein [Bacteroides finegoldii DSM 17565],6T2S_BBB Chain BBB, Glycoside hydrolase family 16 protein [Bacteroides finegoldii DSM 17565],6T2S_CCC Chain CCC, Glycoside hydrolase family 16 protein [Bacteroides finegoldii DSM 17565]
6T2O_AAA	4.31e-26	42	256	51	271	ChainAAA, Glycosyl hydrolase family 16 [Bacteroides caccae ATCC 43185],6T2O_BBB Chain BBB, Glycosyl hydrolase family 16 [Bacteroides caccae ATCC 43185]
6T2P_AAA	1.17e-25	42	256	51	271	ChainAAA, Glycosyl hydrolase family 16 [Bacteroides caccae ATCC 43185],6T2P_BBB Chain BBB, Glycosyl hydrolase family 16 [Bacteroides caccae ATCC 43185],6T2Q_AAA Chain AAA, Glycosyl hydrolase family 16 [Bacteroides caccae ATCC 43185],6T2Q_BBB Chain BBB, Glycosyl hydrolase family 16 [Bacteroides caccae ATCC 43185]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9ZG90	1.60e-48	21	259	50	288	Keratan-sulfate endo-1,4-beta-galactosidase OS=Sphingobacterium multivorum OX=28454 PE=1 SV=1
C1IE32	3.36e-16	20	245	13	247	Glucan endo-1,3-beta-glucosidase OS=Cryptopygus antarcticus OX=187623 PE=1 SV=1
O33680	1.30e-12	91	258	303	457	Endo-1,3-1,4-beta-glycanase ExsH OS=Rhizobium meliloti (strain 1021) OX=266834 GN=exsH PE=1 SV=1
Q8N0N3	3.79e-11	90	236	130	303	Beta-1,3-glucan-binding protein OS=Penaeus monodon OX=6687 PE=2 SV=1
Q9Z3Q2	6.28e-11	86	258	298	457	Endo-1,3-1,4-beta-glycanase EglC OS=Rhizobium meliloti (strain 1021) OX=266834 GN=eglC PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000001	0.000274	0.999761	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001735_01190.