CAZyme Information: MGYG000001735_01355

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides
• CAZyme ID: MGYG000001735_01355
• CAZy Family: GH63
• CAZyme Description: Glucosidase YgjK

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
670	MGYG000001735_12|CGC1	76682.58	4.8882

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001735	5309957	MAG	Sweden	Europe

• Gene Location: Start: 10731; End: 12743 Strand: -

Full Sequence      

MNNIINYFSVYSALLLSSCNIGLKNNVLPEEIKNDRDDFYNLINIKNVPQTESDRDFFVF
ADLGSWTGYALPENEENKLAGSFIGPYMMTGRGWIARSLAEPIIRVDGEKFDLARNIQTS
KYYPGKLVQEFRNEQLSFVTELCFLSSRTALIRSRVDNTGGREVSVSLQWRGGVYENSAI
LSVEEKGIRIANNREQAFTYASFPTAEDVRLVGTDSLLVVEKEELRLSPGGSFETASTQT
FAFDRGALDKELEQLKDLEVNLVFSENEKRWNTYLSSLFDNDSPFMKENKYRHVVVKALM
TLIANWRTPSGDILHDGTYPSYNGFFGIWSWDSWKHAAANALYNPEEAKNEIRCLFDYQA
ENGMIPDFVSRNKERINWRDTKPPLAAWAVKCIYDATGDKAFVAEMFDKLYKYHQWWYTD
RDHDKNGICEYGSTDGTLVAACWESGMDNGVRFDDAVMLKNEPEKAWSMNQENICLNSFL
YAEKNFLAEMAEILDKKELALQLNKEAEALKNHIQTKMFDEETGFFYDTRLGTGEFIKVM
GAECWLPLWAGVATSQQARKVLEKMLDPEKFNSKVPLGTLAVSHPRLRPTRGYWRGPVWI
DQVYFGVTGLRKYGFNKEADQLITQYIDNVQGLLTDGPIHENYNPLTGETLNCPNFSWSS
AMTIRMLLNK

Enzyme Prediction     

No EC number prediction in MGYG000001735_01355.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH63	215	666	1e-106	0.5596491228070175

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10137	PRK10137	1.02e-147	1	669	1	781	alpha-glucosidase; Provisional
pfam01204	Trehalase	7.28e-19	381	667	178	505	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.
COG3408	GDB1	1.30e-18	326	668	282	604	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
PLN02567	PLN02567	4.68e-11	383	667	205	541	alpha,alpha-trehalase
COG1626	TreA	1.79e-09	474	667	354	549	Neutral trehalase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUU00825.1	1.35e-300	13	670	15	669
QQA30345.1	1.35e-300	13	670	15	669
QUT61859.1	1.35e-300	13	670	15	669
BBK86094.1	1.56e-299	13	670	15	669
BBD44200.1	2.68e-296	24	669	21	671

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W7S_A	2.02e-96	37	661	3	747	Escherichiacoli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7S_B Escherichia coli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7T_A Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7T_B Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7U_A Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12],3W7U_B Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12]
3W7X_A	1.08e-95	37	661	3	747	Crystalstructure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],3W7X_B Crystal structure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],5CA3_A Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5CA3_B Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
3W7W_A	1.50e-95	37	661	3	747	Crystalstructure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],3W7W_B Crystal structure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],5GW7_A Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5GW7_B Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
3D3I_A	4.67e-92	37	661	4	748	Crystalstructural of Escherichia coli K12 YgjK, a glucosidase belonging to glycoside hydrolase family 63 [Escherichia coli K-12],3D3I_B Crystal structural of Escherichia coli K12 YgjK, a glucosidase belonging to glycoside hydrolase family 63 [Escherichia coli K-12]
7PQQ_B	9.99e-44	439	661	41	296	ChainB, Anti-RON nanobody,Megabody 91,Glucosidase YgjK [Lama glama]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P42592	1.83e-95	37	661	26	770	Glucosidase YgjK OS=Escherichia coli (strain K12) OX=83333 GN=ygjK PE=1 SV=1
D8QTR2	2.64e-23	329	667	98	485	Mannosylglycerate hydrolase MGH1 OS=Selaginella moellendorffii OX=88036 GN=MGH PE=1 SV=1
D8T3S4	6.29e-23	329	667	98	485	Mannosylglycerate hydrolase MGH2 OS=Selaginella moellendorffii OX=88036 GN=SELMODRAFT_447962 PE=3 SV=1
P94250	1.08e-11	323	646	62	356	Uncharacterized protein BB_0381 OS=Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31) OX=224326 GN=BB_0381 PE=4 SV=2
K5BDL0	2.28e-11	328	667	39	445	Glucosylglycerate hydrolase OS=Mycolicibacterium hassiacum (strain DSM 44199 / CIP 105218 / JCM 12690 / 3849) OX=1122247 GN=ggh PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000166	0.028461	0.971372	0.000011	0.000016	0.000014

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001735_01355.