CAZyme Information: MGYG000001735_01765

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides
• CAZyme ID: MGYG000001735_01765
• CAZy Family: GH16
• CAZyme Description: Beta-glucanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
286	MGYG000001735_17|CGC1	32815.56	4.5608

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001735	5309957	MAG	Sweden	Europe

• Gene Location: Start: 7522; End: 8382 Strand: -

Full Sequence      

MKYSITYLLLFGAFQLSACNGQDAEIPSPDNKPETEIVTPPGYTLVWHDEFDDDRLPNGK
PSMPDTKLWWYETGNNGWGNNEIQRYISGVQSKDTCARIVDGTLEIIARKVHNEILSARL
NSTESWTYGYFEARLQLPQGKGTWPAFWMMPEKFTAWPDDGEIDIMEEVGYNPNQIFSTI
HCKAYNHSIGTQKTGEIHIADAEEKFHVYAVEWTKDFIKGYVDGECYFTFNNDHQGNKDT
WPFDAPFYIKLNLAWGGNWGGAEGVDESQLPATYKIDYVRVFQRTK

Enzyme Prediction     

No EC number prediction in MGYG000001735_01765.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	47	282	2e-74	0.9956521739130435

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd08023	GH16_laminarinase_like	6.65e-89	47	282	1	235	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
cd02182	GH16_Strep_laminarinase_like	6.46e-44	42	283	1	259	Streptomyces laminarinase-like, member of glycosyl hydrolase family 16. Proteins similar to Streptomyces sioyaensis beta-1,3-glucanase (laminarinase) present in Actinomycetales as well as Peziomycotina. Laminarinases belong to glycosyl hydrolase family 16 and hydrolyze the glycosidic bond of the 1,3-beta-linked glucan, a major component of fungal and plant cell walls and the structural and storage polysaccharides (laminarin) of marine macro-algae. Members of the GH16 family have a conserved jelly roll fold with an active site channel.
pfam00722	Glyco_hydro_16	9.37e-29	97	280	6	168	Glycosyl hydrolases family 16.
cd00413	Glyco_hydrolase_16	2.74e-28	49	282	1	210	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
COG2273	BglS	4.89e-25	100	281	85	262	Beta-glucanase, GH16 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDO69449.1	6.34e-141	1	284	89	370
AVM56737.1	4.11e-137	32	284	121	374
ADV43667.1	1.74e-129	37	284	119	366
ADD61979.1	6.21e-125	29	284	118	366
ALJ43895.1	1.13e-124	29	284	115	363

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3ILN_A	1.16e-76	41	283	3	248	ChainA, Laminarinase [Rhodothermus marinus],3ILN_B Chain B, Laminarinase [Rhodothermus marinus]
6XOF_A	1.73e-72	22	284	6	268	ChainA, GH16 family protein [uncultured bacterium]
6XQF_A	9.85e-72	22	284	6	268	ChainA, GH16 family protein [uncultured bacterium],6XQG_A Chain A, GH16 family protein [uncultured bacterium],6XQH_A Chain A, GH16 family protein [uncultured bacterium],6XQL_A Chain A, GH16 family protein [uncultured bacterium],6XQM_A Chain A, GH16 family protein [uncultured bacterium]
5WUT_A	3.59e-55	42	283	4	235	Crystalstructure of laminarinase from Flavobacterium sp. UMI-01 [Flavobacterium sp.],5WUT_B Crystal structure of laminarinase from Flavobacterium sp. UMI-01 [Flavobacterium sp.]
2HYK_A	1.69e-49	44	283	8	243	Thecrystal structure of an endo-beta-1,3-glucanase from alkaliphilic Nocardiopsis sp.strain F96 [Nocardiopsis sp. F96]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P45798	7.72e-75	41	283	38	283	Beta-glucanase OS=Rhodothermus marinus OX=29549 GN=bglA PE=1 SV=1
C1IE32	7.75e-44	43	280	20	265	Glucan endo-1,3-beta-glucosidase OS=Cryptopygus antarcticus OX=187623 PE=1 SV=1
P23903	4.90e-42	27	283	400	680	Glucan endo-1,3-beta-glucosidase A1 OS=Niallia circulans OX=1397 GN=glcA PE=1 SV=1
Q27082	7.80e-34	41	283	23	253	Clotting factor G alpha subunit OS=Tachypleus tridentatus OX=6853 PE=1 SV=1
Q9ZG90	2.99e-32	2	283	5	288	Keratan-sulfate endo-1,4-beta-galactosidase OS=Sphingobacterium multivorum OX=28454 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000015	0.012945	0.987069	0.000006	0.000007	0.000005

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001735_01765.