CAZyme Information: MGYG000001735_02252

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides
• CAZyme ID: MGYG000001735_02252
• CAZy Family: GH35
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
779		88641.72	5.0272

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001735	5309957	MAG	Sweden	Europe

• Gene Location: Start: 2453; End: 4792 Strand: +

Full Sequence      

MNYSMKTVTILMALLICVLTGCKNESGNGGTFEIGDKTFLLNGKPFVIKAAEIHYTRIPV
EYWEHRIQMCKALGMNTICIYAFWNIHEQKPGEFDFTGQNDIAAFCRLAQKYDMYIMLRP
GPYVCSEWEMGGLPWWLLKKEDIQLRTNDPYFMERTRIYMNEIGKQVADLQITRGGNIIM
VQVENEYGSYATDKEYIARNRDILREAGFTDVPLFQCDWSSNFLNNALDDLVWTINFGTG
ANIDEQFKKLKEARPNTPLMCSEFWSGWFDHWGRKHETRDAETMIAGLKDMLDRNISFSL
YMTHGGTTFGHWGGANSPAYSAMCSSYDYDAPISEAGWTTPKYYKLREFMAGYMAPGEVM
PEVPEAFPVIEIPEFELNETALLFDNLPEPKTSHDIKTMEQFDQGWGSILYRTTLPAVKA
GTTLLIDEVHDWAQVFVDGKLIGRLDRRRGENTIKLPAVAAGSQLDILIEAMGRVNFDKA
IHDRKGITEKVALITESSTDELKDWQVYNLPVDYSFVKDKKFATGKKTEGPAYYRATFNL
ETPGDVFLDMQTWGKGMVWVNGRAMGRFWEIGPQQTLFMPGCWLKKGENEIIVLDLKGPE
KATIKGVNQPILDMLRAEAPLTNRKEGQNLDLKNENPVGQGSLKAGNGWQEVRFDAPVEA
RHFCLEALNAQDGGNNAAIAEFYLLDENGNPLGRQHWQIGYADSEETSGGNFTADKIYDL
QESTYWSTARGAKYPHQVVIDLRETVTVSGFRYLPRAEEGYPGMIKDYKAYTRMTPFRY

Enzyme Prediction     

No EC number prediction in MGYG000001735_02252.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH35	39	350	2.6e-117	0.990228013029316

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01301	Glyco_hydro_35	3.06e-165	38	348	1	313	Glycosyl hydrolases family 35.
PLN03059	PLN03059	7.84e-48	7	643	5	753	beta-galactosidase; Provisional
COG1874	GanA	1.17e-37	37	607	6	601	Beta-galactosidase GanA [Carbohydrate transport and metabolism].
pfam00754	F5_F8_type_C	7.26e-06	702	774	2	72	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.
cd00057	FA58C	0.001	693	769	8	79	Substituted updates: Jan 31, 2002

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT50204.1	0.0	10	777	7	778
QRO23434.1	0.0	1	778	1	781
QUT77306.1	0.0	10	779	5	776
QIU94062.1	0.0	11	779	8	778
BCA48215.1	0.0	11	779	8	778

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6EON_A	0.0	5	778	1	778	GalactanaseBT0290 [Bacteroides thetaiotaomicron VPI-5482]
3D3A_A	2.51e-313	30	628	6	605	Crystalstructure of a beta-galactosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
4MAD_A	1.06e-137	36	612	21	593	ChainA, Beta-galactosidase [Niallia circulans],4MAD_B Chain B, Beta-galactosidase [Niallia circulans]
3WF3_A	3.31e-123	20	612	23	645	Crystalstructure of human beta-galactosidase mutant I51T in complex with Galactose [Homo sapiens],3WF3_B Crystal structure of human beta-galactosidase mutant I51T in complex with Galactose [Homo sapiens],3WF3_C Crystal structure of human beta-galactosidase mutant I51T in complex with Galactose [Homo sapiens],3WF3_D Crystal structure of human beta-galactosidase mutant I51T in complex with Galactose [Homo sapiens],3WF4_A Crystal structure of human beta-galactosidase mutant I51T in complex with 6S-NBI-DGJ [Homo sapiens],3WF4_B Crystal structure of human beta-galactosidase mutant I51T in complex with 6S-NBI-DGJ [Homo sapiens],3WF4_C Crystal structure of human beta-galactosidase mutant I51T in complex with 6S-NBI-DGJ [Homo sapiens],3WF4_D Crystal structure of human beta-galactosidase mutant I51T in complex with 6S-NBI-DGJ [Homo sapiens]
3WEZ_A	6.53e-123	20	612	23	645	Crystalstructure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WEZ_B Crystal structure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WEZ_C Crystal structure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WEZ_D Crystal structure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WF0_A Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF0_B Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF0_C Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF0_D Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF1_A Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF1_B Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF1_C Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF1_D Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF2_A Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens],3WF2_B Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens],3WF2_C Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens],3WF2_D Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P48982	7.30e-141	7	579	5	573	Beta-galactosidase OS=Xanthomonas manihotis OX=43353 GN=bga PE=1 SV=1
Q9TRY9	3.86e-126	10	612	13	645	Beta-galactosidase OS=Canis lupus familiaris OX=9615 GN=GLB1 PE=1 SV=3
P16278	1.16e-123	10	612	12	644	Beta-galactosidase OS=Homo sapiens OX=9606 GN=GLB1 PE=1 SV=2
Q5R7P4	6.86e-122	2	612	3	644	Beta-galactosidase OS=Pongo abelii OX=9601 GN=GLB1 PE=2 SV=1
Q60HF6	4.65e-120	2	612	3	644	Beta-galactosidase OS=Macaca fascicularis OX=9541 GN=GLB1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000061	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001735_02252.