CAZyme Information: MGYG000001735_02381

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides
• CAZyme ID: MGYG000001735_02381
• CAZy Family: GH146
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
681	MGYG000001735_27|CGC2	78053.76	5.7188

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001735	5309957	MAG	Sweden	Europe

• Gene Location: Start: 55366; End: 57411 Strand: +

Full Sequence      

MTMNKLIKIFFASFATLAIASAAPAGGESVSGNYLNNRQPLLQKTYIELPLGSIKAEGWM
QEQLVRMKNGMTGHLDEVYEKVMGPRNGWLGGDGDVWERGPYWIDGLLPLAYILNDQALI
EKIKPWIEWTLASQKPNGYFGPDTDRSYEPGLQRDNAQDWWPKMVMLKIMQQYYTATNDI
RVIGFLTNYFKYQLAELPKNPLGKWTFWGEQRGGDNLMIVYWLYNITGDKFLLDLGELIH
KQTFNWTDIFLNQDHLSRQHSLHCVNLAQGFKEPIVYYQQNKDPKQIQATKKAVHDIHNT
IGLPTGLWGGDELLRFGKPTAGSELCTAVEMMYSLEEMLEITGDIQWADYLERVTYNALP
TQVTDDYSGRQYYQQTNQVAVTRDWREFSTPHEDTDILFGELTGYPCCTSNLHQGWPKFV
QNLWYATADNGIAALVYAPSQVSAKIANGITVNIKEETAYPFEEAIRFNISFADKKVKQA
FFPFHIRIPAWCKNPIVKLNGEPITIDAYPGTVARVNREWKNGDILSLELPMEVAVSRWY
DNSAVVERGPLVYALKMNEKWEKKTFENEKAGEYGKWYYEVTSDSPWNYALLHRSFSSEQ
IKTSFTVEKSSTVAIYPWNVENAPIRIKTKAKRVNNWTLVRGSAGPVPFFTQQGNDVGEE
EMIELIPYGCTTLRITEFPVR

Enzyme Prediction     

No EC number prediction in MGYG000001735_02381.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH146	182	554	8.8e-37	0.6998011928429424

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	6.65e-68	87	554	51	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	3.23e-29	320	555	288	502	Uncharacterized conserved protein, DUF1680 family [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATP55412.1	1.24e-161	1	680	1	650
ALL07583.1	1.30e-157	31	680	25	650
QNN43859.1	1.78e-153	37	680	29	648
ACU60445.1	2.59e-153	37	680	31	650
AMP98056.1	3.85e-153	34	680	28	650

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MQO_A	5.90e-25	223	555	310	608	Glycosidehydrolase BT_1003 [Bacteroides thetaiotaomicron]
4QJY_A	2.12e-19	66	555	45	561	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	1.06e-17	66	555	45	561	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
6EX6_A	5.39e-13	93	553	69	544	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]
3WRE_A	1.04e-10	320	553	334	565	Thecrystal structure of native HypBA1 from Bifidobacterium longum JCM 1217 [Bifidobacterium longum subsp. longum JCM 1217],3WRG_A The complex structure of HypBA1 with L-arabinose [Bifidobacterium longum subsp. longum JCM 1217]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
E8MGH8	5.71e-10	320	553	334	565	Non-reducing end beta-L-arabinofuranosidase OS=Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b) OX=565042 GN=hypBA1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000221	0.999113	0.000166	0.000167	0.000158	0.000140

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001735_02381.