CAZyme Information: MGYG000001735_02610

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides
• CAZyme ID: MGYG000001735_02610
• CAZy Family: GH76
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
371	MGYG000001735_32|CGC1	41874.93	4.6061

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001735	5309957	MAG	Sweden	Europe

• Gene Location: Start: 15093; End: 16208 Strand: -

Full Sequence      

MKNILLFLFLPLWFWACGDDDNNPVNPDEGEGIDWYAAADSSTTALVNSFWNAGGKYFNY
DSNGNETFHYWPQAHALDVLVDASLRTGDAKYKTYFDQWFEGVKVKNGNTFRNDFYDDME
WNALAILRAYQVTKDQKYKEAALQIWEYIKVGWNTNAGGGITWVKGKEYSKNACSNGPAC
ILAARLFQEFGNEADKEWALKIYNWEKSTLFNSKNGMVYDNINSNTGEIQKDWIFTYNEG
TFIGSAVELYKILGEKSYLNDAVLAADYTISTLVNNSILKDEGSGDGGLFKGIFIRYFVE
LIQQDRLDVAAKRRYMQFLNVNAEALWTRGTNKSSVLFGIYWGTAPGASTGLTEQLSGCM
LIEAAALLNNK

Enzyme Prediction     

No EC number prediction in MGYG000001735_02610.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	52	355	2e-90	0.8631284916201117

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4833	COG4833	8.02e-60	35	366	3	368	Predicted alpha-1,6-mannanase, GH76 family [Carbohydrate transport and metabolism].
pfam03663	Glyco_hydro_76	2.41e-45	35	359	2	348	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.
pfam07470	Glyco_hydro_88	1.25e-04	71	219	29	174	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
cd04434	LanC_like	0.001	123	322	8	194	Cyclases involved in the biosynthesis of lantibiotics, and similar proteins. LanC is the cyclase enzyme of the lanthionine synthetase. Lanthionine is a lantibiotic, a unique class of peptide antibiotics. They are ribosomally synthesized as a precursor peptide and then post-translationally modified to contain thioether cross-links called lanthionines (Lans) or methyllanthionines (MeLans), in addition to 2,3-didehydroalanine (Dha) and (Z)-2,3-didehydrobutyrine (Dhb). These unusual amino acids are introduced by the dehydration of serine and threonine residues, followed by thioether formation via addition of cysteine thiols, catalysed by LanB and LanC or LanM. LanC, the cyclase component, is a zinc metalloprotein, whose bound metal has been proposed to activate the thiol substrate for nucleophilic addition. A related domain is also present in LanM and other pro- and eukaryotic proteins with poorly characterized functions.
cd04792	LanM-like	0.007	123	186	657	720	Cyclases involved in the biosynthesis of class II lantibiotics, and similar proteins. LanM-like proteins. LanM is a bifunctional enzyme, involved in the synthesis of class II lantibiotics. It is responsible for both the dehydration and the cyclization of the precursor-peptide during lantibiotic synthesis. The C-terminal domain shows similarity to LanC, the cyclase component of the lan operon, but the N terminus seems to be unrelated to the dehydratase, LanB.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AHW60278.1	5.88e-194	2	371	28	396
CEA14963.1	4.40e-177	5	371	8	377
QGY43662.1	4.75e-176	1	371	1	374
QIA07428.1	2.03e-168	2	368	3	373
QIK58582.1	7.67e-150	1	367	1	369

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6SHD_A	2.00e-96	31	368	50	389	Structureof the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6],6SHD_B Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6],6SHD_C Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6]
6Y8F_A	6.61e-95	31	368	51	390	ChainA, Alpha-1,6-endo-mannanase GH76A mutant [Salegentibacter sp. Hel_I_6]
6SHM_A	5.29e-94	31	368	51	390	Aninactive (D136A and D137A) variant of alpha-1,6-mannanase, GH76A of Salegentibacter sp. HEL1_6 in complex with alpha-1,6-mannotetrose [Salegentibacter sp. Hel_I_6]
3K7X_A	3.19e-59	65	368	40	340	ChainA, Lin0763 protein [Listeria innocua]
4BOK_A	3.31e-40	36	364	2	337	ChainA, Alpha-1,6-mannanase [Niallia circulans]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000083	0.058560	0.941307	0.000022	0.000027	0.000023

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001735_02610.