CAZyme Information: MGYG000001735_02814

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides
• CAZyme ID: MGYG000001735_02814
• CAZy Family: GH88
• CAZyme Description: Unsaturated chondroitin disaccharide hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
401	MGYG000001735_37|CGC1	45013.73	5.4116

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001735	5309957	MAG	Sweden	Europe

• Gene Location: Start: 19876; End: 21081 Strand: -

Full Sequence      

MKNWIALAFSAFLISCGGAPKTVEKSFVDENVDFARAQIGNEIAVIEASGECLNPVTLKA
DSSVYYCGYGDWRSGFFPGSVWYLYELSGDTALLPLARKYTLAIEEAKNLTWHHDIGFII
NCSFGNGLRLTADPSYKDVMVQAAKSLSTRFREAPQVIQSWNVDRGWQSERGWECPVIID
NMMNLELMFEATRLSGDSSFYKIAVAHADRTLQEHFRPDGSCYHVIDYSLKDGSVRHRHT
AQGYAHESAWSRGQAWAIYGYVVCYRETGDRKYLDQALKTFNFMKNHKAMPADLIPYWDM
DAPNIPNEPRDVSSASCIASALYEISTLDVENAADYKAYADGIMTSLASPAYRAALGTNG
NFLLMHSVGSIPHNSEIDVPLNYADYYFMEALKRKQDIEAK

Enzyme Prediction     

No EC number prediction in MGYG000001735_02814.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH88	70	394	5.4e-119	0.9756838905775076

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	5.82e-08	71	318	28	259	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT49570.1	1.36e-256	1	399	2	400
CUA16984.1	1.37e-219	1	399	3	402
ANQ62645.1	1.37e-219	1	399	3	402
CAH06102.1	1.37e-219	1	399	3	402
QUU05426.1	1.37e-219	1	399	3	402

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3WIW_A	4.40e-98	53	399	54	392	Crystalstructure of unsaturated glucuronyl hydrolase specific for heparin [Pedobacter heparinus DSM 2366]
2ZZR_A	1.07e-39	71	394	67	388	Crystalstructure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae [Streptococcus agalactiae]
3ANJ_A	1.09e-39	71	394	68	389	Crystalstructure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae [Streptococcus agalactiae serogroup III]
3WUX_A	1.52e-39	71	394	68	389	Crystalstructure of unsaturated glucuronyl hydrolase mutant D115N/K370S from Streptococcus agalactiae [Streptococcus agalactiae NEM316]
3ANI_A	5.65e-39	71	394	68	389	Crystalstructure of unsaturated glucuronyl hydrolase mutant D175N from Streptcoccus agalactiae [Streptococcus agalactiae serogroup III],3ANK_A Crystal structure of unsaturated glucuronyl hydrolase mutant D175N from Streptcoccus agalactiae complexed with dGlcA-GalNAc6S [Streptococcus agalactiae serogroup III]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KLZ3	5.54e-101	71	401	76	400	Unsaturated glucuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21900 PE=1 SV=1
Q8E372	5.97e-39	71	394	68	389	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus agalactiae serotype III (strain NEM316) OX=211110 GN=gbs1889 PE=1 SV=1
Q8DR77	5.75e-38	71	394	66	387	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=ugl PE=1 SV=1
Q9A0T3	1.15e-35	71	394	69	390	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus pyogenes serotype M1 OX=301447 GN=ugl PE=1 SV=1
Q9RC92	1.05e-34	71	394	41	363	Unsaturated glucuronyl hydrolase OS=Bacillus sp. (strain GL1) OX=84635 GN=ugl PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000052	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001735_02814.