CAZyme Information: MGYG000001735_03001

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides
• CAZyme ID: MGYG000001735_03001
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
377		43223.79	7.2034

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001735	5309957	MAG	Sweden	Europe

• Gene Location: Start: 10135; End: 11268 Strand: -

Full Sequence      

MKYFLIAGEASGDLHASNLMAALKEEDPEADFRFFGGDLMQAVGGTLVKHYREMAFMGFI
PVLLNLRTILNNMKTCEEDIRRYQPDVVILIDYPGFNLKIAKFVKTVLHLPVYYYISPKI
WAWKQYRIKDFRRYVDRMFCILPFETEFFHKLNYSVDYVGNPSVDSVAQYKEKQAAAVDT
FIADEGLPDKPILALLAGSRRQEIKDNLPTMLEVAASYPDYQPVIAGAPGLEPEYYKQYI
GNHQARIVFGKTYDLLQHSHTALVTSGTATLETSLFRVPQVVCYYTPAGRLASFIFRNFF
HTKYISLVNLIAGREVVQELFGARFSTLQIHEELDRILNNPAYRNQMLEGYDEVIRLLGK
PGASRRTAELIYQSLRD

Enzyme Prediction     

No EC number prediction in MGYG000001735_03001.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	357	3.7e-113	0.9858757062146892

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	1.78e-107	1	376	2	376	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	4.11e-96	1	376	2	380	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	1.19e-76	4	366	2	366	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	4.14e-65	5	369	10	380	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	9.57e-48	1	374	2	347	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT50508.1	1.29e-230	1	376	1	376
BBK92630.1	1.06e-229	1	375	1	375
QIX64622.1	1.06e-229	1	375	1	375
QUR47916.1	1.06e-229	1	375	1	375
ABR44355.1	3.03e-229	1	375	1	375

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	1.29e-36	5	354	11	361	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	1.29e-36	5	354	11	361	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q1D393	1.46e-68	2	375	6	378	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1
Q39T49	1.87e-58	2	375	8	380	Lipid-A-disaccharide synthase OS=Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15) OX=269799 GN=lpxB PE=3 SV=1
Q2LVL8	2.56e-58	5	368	8	371	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1
Q2IL69	2.56e-58	2	376	10	383	Lipid-A-disaccharide synthase OS=Anaeromyxobacter dehalogenans (strain 2CP-C) OX=290397 GN=lpxB PE=3 SV=1
B8JE78	5.05e-58	2	376	10	383	Lipid-A-disaccharide synthase OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) OX=455488 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000027	0.000016	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001735_03001.