CAZyme Information: MGYG000001735_03424

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides
• CAZyme ID: MGYG000001735_03424
• CAZy Family: GH97
• CAZyme Description: Retaining alpha-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
632	MGYG000001735_60|CGC1	71305.91	6.41

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001735	5309957	MAG	Sweden	Europe

• Gene Location: Start: 15735; End: 17633 Strand: -

Full Sequence      

MKKVNLLLCALLHPLWICAQTVLPLTSPSETLKADIQVNEKSVQIALFDKGGKVVEAKTL
QLELDKNILAGNWQVANQTRTSADQTWQPVYGERSLVTNRYNELELLLRSNENQKEMTLF
VRLYDEGLAFRYAFDKLDFWNCTLTSEKTQFLFGHDCDTWVTGNAQGAYSKTKLSALKGV
GDRPQVVQVNDRKFVAIGEAALVDYSRMKLGKSETGIGVQSVLSGKVNLDLAGYQSPWRY
VMVADHPGQLVQNNYFVLNLNEPNQIENTSWIKPGQVIREVTLTTAGGLACVDFAAENGI
EYVEFDAGWYGDEYNPESDASTITVDPKRSKGPLDLHKVIEYADQKGIGIILYVNMKALS
KQLDQILPLYKQWGVKGLKYGFVDVGDQYSTAWLHQAIRKAAKYELMVDVHDEYRPTGYS
RTYPNLVTQEGIRGDEESPNLNQSVYTLYNRMICGAGDNTNCFFAERVAEKMGGRAAQLA
KRIAIYSPWQFIFWYDRPYKAPSRAGGAGSAESVIKTDAITDFYCSIPVVWDDTRFYEGD
MDSYAVVARRSASDWYVSVLNAGDKRQVTIPTDMLKSASRYKATLYYQPGNKKDVVRVKE
LKWQEQDYLTLEVEGDSGCVLHFTPCKRVEKK

Enzyme Prediction     

No EC number prediction in MGYG000001735_03424.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH97	17	623	7.4e-138	0.9841521394611727

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam14508	GH97_N	1.42e-54	27	263	1	235	Glycosyl-hydrolase 97 N-terminal. This N-terminal domain of glycosyl-hydrolase-97 contributes part of the active site pocket. It is also important for contact with the catalytic and C-terminal domains of the whole.
pfam10566	Glyco_hydro_97	3.54e-51	269	490	2	255	Glycoside hydrolase 97. This domain is the catalytic region of the bacterial glycosyl-hydrolase family 97. This central part of the GH97 family protein sequences represents a typical and complete (beta/alpha)8-barrel or catalytic TIM-barrel type domain. The N- and C-terminal parts of the sequences, mainly consisting of beta-strands, form two additional non-catalytic domains. In all known glycosidases with the (beta-alpha)8-barrel fold, the amino acid residues at the active site are located on the C-termini of the beta-strands.
pfam14509	GH97_C	5.14e-19	531	624	1	97	Glycosyl-hydrolase 97 C-terminal, oligomerization. Glycosyl-hydrolase-97 is made up of three tightly linked and highly conserved globular domains. The C-terminal domain is found to be necessary for oligomerization of the whole molecule in order to create the active-site pocket and the Ca++-binding site.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQT29248.1	1.05e-231	23	621	22	625
QQT54718.1	1.13e-230	23	621	22	623
QRY59940.1	1.71e-230	23	621	22	625
QOD61816.1	1.58e-222	25	621	32	632
QUT49474.1	4.77e-213	247	624	14	392

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5E1Q_A	8.03e-52	27	586	20	614	Mutant(D415G) GH97 alpha-galactosidase in complex with Gal-Lac [Bacteroides thetaiotaomicron VPI-5482],5E1Q_B Mutant (D415G) GH97 alpha-galactosidase in complex with Gal-Lac [Bacteroides thetaiotaomicron VPI-5482]
3A24_A	6.05e-51	27	586	6	600	Crystalstructure of BT1871 retaining glycosidase [Bacteroides thetaiotaomicron],3A24_B Crystal structure of BT1871 retaining glycosidase [Bacteroides thetaiotaomicron]
3WFA_A	3.94e-47	25	586	5	661	Catalyticrole of the calcium ion in GH97 inverting glycoside hydrolase [Bacteroides thetaiotaomicron],3WFA_B Catalytic role of the calcium ion in GH97 inverting glycoside hydrolase [Bacteroides thetaiotaomicron]
2JKA_A	3.97e-47	25	586	14	670	Nativestructure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JKA_B Native structure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JKE_A Structure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron in complex with deoxynojirimycin [Bacteroides thetaiotaomicron VPI-5482],2JKE_B Structure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron in complex with deoxynojirimycin [Bacteroides thetaiotaomicron VPI-5482],2JKP_A Structure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron in complex with castanospermine [Bacteroides thetaiotaomicron VPI-5482],2JKP_B Structure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron in complex with castanospermine [Bacteroides thetaiotaomicron VPI-5482]
2D73_A	4.38e-47	25	586	25	681	CrystalStructure Analysis of SusB [Bacteroides thetaiotaomicron VPI-5482],2D73_B Crystal Structure Analysis of SusB [Bacteroides thetaiotaomicron VPI-5482],2ZQ0_A Crystal structure of SusB complexed with acarbose [Bacteroides thetaiotaomicron],2ZQ0_B Crystal structure of SusB complexed with acarbose [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8A6L0	1.61e-53	1	586	1	621	Retaining alpha-galactosidase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_1871 PE=1 SV=1
G8JZS4	2.40e-46	25	586	25	681	Glucan 1,4-alpha-glucosidase SusB OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=susB PE=1 SV=1
D7CFN7	3.90e-38	26	571	44	573	Probable retaining alpha-galactosidase OS=Streptomyces bingchenggensis (strain BCW-1) OX=749414 GN=SBI_01652 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.004413	0.718341	0.276431	0.000282	0.000247	0.000252

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001735_03424.