CAZyme Information: MGYG000001735_04040

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides
• CAZyme ID: MGYG000001735_04040
• CAZy Family: CBM50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
599		68230.04	7.9154

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001735	5309957	MAG	Sweden	Europe

• Gene Location: Start: 6079; End: 7878 Strand: -

Full Sequence      

MNKISIYVLTLCLSFACISLHSQNNRARIITTNELNDNIFYHTIERGQTVYSIATMYGVT
VDDIYRLNPESRESIKAGATLKIPQRDAGSASLEKTEENFLYHTIQPKETLYSLSIRYAV
PGPDIIEANPGLSTSTFTIGKTIRIPATPIESLPTKEVKTVTKEIEYTIEKKETMYRICR
KFNVSSAELIKRNPKLKDGVKAGMVIKIPVETKDVVTETAPVMHERDVNALLTAPREIKR
VNMIKVALLLPFMTNEKTPSANTLRFIEYYEGMLLAVDSLRNSGGSIELSVFDTGNGTKK
LKEVLKDDALKEANLIIGAVYNDQIGPVAEFAEKNNIKYVIPFTSKNDDVLSNANIFQVN
TPHSYLYAKASQAGCDLFANDNVILLKVPGTEEKTDFIKAFKAEMKQRNIPWRELTYSAE
TFPTDMEALLSKEKRSVIVPTSGTLEALNKFKSPLRMLSETKPEYNITMFGYPEWQTYTR
ECLDDFFALNTYIYSNFYADNLAPEVSDFYSKYKTWYSKSLINYFPKYGILGFDTGMFFF
DAIRKYGSNFENNLGKIRYKGIQTCFDFERVNNWGGFINTNIFIVHYQNDYNVTRSEVR

Enzyme Prediction     

No EC number prediction in MGYG000001735_04040.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00118	LysM	6.65e-10	41	83	2	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
cd06347	PBP1_ABC_LivK_ligand_binding-like	6.99e-10	271	548	21	295	type 1 periplasmic ligand-binding domain of uncharacterized ABC (Atpase Binding Cassette)-type active transport systems predicted to be involved in uptake of amino acids, peptides, or inorganic ions. This subgroup includes the type 1 periplasmic ligand-binding domain of uncharacterized ABC (Atpase Binding Cassette)-type active transport systems that are predicted to be involved in uptake of amino acids, peptides, or inorganic ions. This subgroup has high sequence similarity to members of the family of hydrophobic amino acid transporters (HAAT), such as leucine-isoleucine-valine binding protein (LIVBP); however, its ligand specificity has not been determined experimentally.
pfam01476	LysM	1.38e-07	42	84	1	43	LysM domain. The LysM (lysin motif) domain is about 40 residues long. It is found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. The structure of this domain is known.
smart00257	LysM	4.20e-07	41	83	1	44	Lysin motif.
cd19980	PBP1_ABC_ligand_binding-like	7.63e-07	271	585	21	334	type 1 periplasmic ligand-binding domain of uncharacterized ABC (Atpase Binding Cassette)-type active transport systems predicted to be involved in uptake of amino acids, peptides, or inorganic ions. This subgroup includes the type 1 periplasmic ligand-binding domain of uncharacterized ABC (Atpase Binding Cassette)-type active transport systems that are predicted to be involved in uptake of amino acids, peptides, or inorganic ions. This subgroup has high sequence similarity to members of the family of hydrophobic amino acid transporters (HAAT), such as leucine-isoleucine-valine binding protein (LIVBP); however, its ligand specificity has not been determined experimentally.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT48586.1	0.0	1	599	1	600
QUR46882.1	1.86e-315	1	599	1	602
QKH97147.1	1.86e-315	1	599	1	602
BBK90862.1	1.86e-315	1	599	1	602
QUT95613.1	5.31e-315	1	599	1	602

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O05495	1.79e-06	39	147	1	94	Putative sporulation-specific glycosylase YdhD OS=Bacillus subtilis (strain 168) OX=224308 GN=ydhD PE=1 SV=2
Q5HRU2	2.29e-06	42	209	29	191	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) OX=176279 GN=sle1 PE=3 SV=1
Q8CMN2	2.29e-06	42	209	29	191	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200) OX=176280 GN=sle1 PE=3 SV=1
P44493	4.25e-06	23	145	273	429	Probable N-acetylmuramoyl-L-alanine amidase AmiB OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=amiB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000009	0.001687	0.998312	0.000001	0.000002	0.000001

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001735_04040.