CAZyme Information: MGYG000001737_00885

Basic Information

• Species: Eubacterium_R sp000434995
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; Eubacterium_R; Eubacterium_R sp000434995
• CAZyme ID: MGYG000001737_00885
• CAZy Family: GH77
• CAZyme Description: 4-alpha-glucanotransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
510		58774.58	5.0017

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001737	1877486	MAG	Sweden	Europe

• Gene Location: Start: 359474; End: 361006 Strand: +

Full Sequence      

MLKKRGAGVLLHISSMPSEYGVGVFDENVIHFIDKIADMGFTYWQVLPFNPLDGANSPYC
SPSAFAGNYLFINPKGLFDMNLVSEEDYKSNIYTGTPYTADYEFAAKKRLELLKKAFLNI
NDDIAKEIKEFEINNSWLTDYSVFMAVKEQENMKPWWEWSDKHAHYFECIKDIYSYEESA
AFWKFVQYIFYRQWNEIKSYANKKGIAVIGDMPIYVAMDSVDVWSNLPMFLIDEKTLKVE
KVAGVPPDYFSKDGQLWGNPIYDWDAMEKDNYSWWVSRIGHSLKLYDTVRIDHFRAFASY
WAVPAESKTAKIGEWLDGPKMKLFNKIFDAFPNAPIIAEDLGVFGEDVVKLLADTGFPGM
KVVQFGFDPNSDSSHMPHNAVPNSINYVGTHDNNTILGWLWEAGEEERKFALEYCGFYGD
NWGEGGYYSASCRKIIETVWKSSSNVAIIALQDMCGFGSDARMNIPGVPDKNWRFRTTRD
TIDNIDTSYFKHINSLFRRMYPAFDDKKNK

Enzyme Prediction     

EC	2.4.1.25

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH77	11	491	1.1e-146	0.9757085020242915

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK14508	PRK14508	0.0	1	499	1	496	4-alpha-glucanotransferase; Provisional
pfam02446	Glyco_hydro_77	0.0	11	476	1	456	4-alpha-glucanotransferase. These enzymes EC:2.4.1.25 transfer a segment of a (1,4)-alpha-D-glucan to a new 4-position in an acceptor, which may be glucose or (1,4)-alpha-D-glucan.
PLN02635	PLN02635	2.95e-150	3	476	26	499	disproportionating enzyme
COG1640	MalQ	7.07e-135	3	498	12	510	4-alpha-glucanotransferase [Carbohydrate transport and metabolism].
TIGR00217	malQ	2.92e-105	1	499	10	513	4-alpha-glucanotransferase. This enzyme is known as amylomaltase and disproportionating enzyme. [Energy metabolism, Biosynthesis and degradation of polysaccharides]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADO38582.1	2.74e-179	4	500	4	506
ARD65542.1	3.89e-179	4	500	4	506
QCT73240.1	2.55e-177	4	500	4	506
ALU15685.1	5.91e-164	39	500	1	468
AWW25287.1	9.53e-162	2	499	3	506

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1TZ7_A	4.72e-128	5	480	22	486	Aquifexaeolicus amylomaltase [Aquifex aeolicus],1TZ7_B Aquifex aeolicus amylomaltase [Aquifex aeolicus]
6M6T_A	1.84e-119	1	499	1	496	ChainA, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_B Chain B, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_C Chain C, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_D Chain D, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_E Chain E, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_F Chain F, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_G Chain G, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_H Chain H, 4-alpha-glucanotransferase [Streptococcus agalactiae]
5CPQ_A	4.04e-118	4	500	69	564	Disproportionatingenzyme 1 from Arabidopsis - apo form [Arabidopsis thaliana],5CPQ_B Disproportionating enzyme 1 from Arabidopsis - apo form [Arabidopsis thaliana],5CPS_A Disproportionating enzyme 1 from Arabidopsis - maltotriose soak [Arabidopsis thaliana],5CPS_B Disproportionating enzyme 1 from Arabidopsis - maltotriose soak [Arabidopsis thaliana],5CPT_A Disproportionating enzyme 1 from Arabidopsis - beta cyclodextrin soak [Arabidopsis thaliana],5CPT_B Disproportionating enzyme 1 from Arabidopsis - beta cyclodextrin soak [Arabidopsis thaliana],5CQ1_A Disproportionating enzyme 1 from Arabidopsis - cycloamylose soak [Arabidopsis thaliana],5CQ1_B Disproportionating enzyme 1 from Arabidopsis - cycloamylose soak [Arabidopsis thaliana],5CSU_A Disproportionating enzyme 1 from Arabidopsis - acarviostatin soak [Arabidopsis thaliana],5CSU_B Disproportionating enzyme 1 from Arabidopsis - acarviostatin soak [Arabidopsis thaliana],5CSY_A Disproportionating enzyme 1 from Arabidopsis - acarbose soak [Arabidopsis thaliana],5CSY_B Disproportionating enzyme 1 from Arabidopsis - acarbose soak [Arabidopsis thaliana]
1X1N_A	2.73e-114	4	486	25	508	Structuredetermination and refinement at 1.8 A resolution of Disproportionating Enzyme from Potato [Solanum tuberosum],6LX1_A Potato D-enzyme complexed with Acarbose [Solanum tuberosum],6LX2_A Potato D-enzyme complexed with CA26 [Solanum tuberosum]
7COV_A	1.25e-113	4	486	77	560	PotatoD-enzyme, native (substrate free) [Solanum tuberosum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q59266	8.38e-138	11	484	1	470	4-alpha-glucanotransferase OS=Clostridium butyricum OX=1492 GN=malQ PE=1 SV=1
O66937	6.87e-128	5	480	2	466	4-alpha-glucanotransferase OS=Aquifex aeolicus (strain VF5) OX=224324 GN=malQ PE=1 SV=1
P0A3Q1	1.83e-127	2	508	1	504	4-alpha-glucanotransferase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=malQ PE=3 SV=1
P0A3Q0	1.83e-127	2	508	1	504	4-alpha-glucanotransferase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=malQ PE=3 SV=1
P72785	9.41e-122	1	501	1	502	4-alpha-glucanotransferase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=malQ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000022	0.000011	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001737_00885.