CAZyme Information: MGYG000001738_00302

Basic Information

• Species: Duncaniella sp001701225
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; Duncaniella; Duncaniella sp001701225
• CAZyme ID: MGYG000001738_00302
• CAZy Family: GH36
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
668		74062.41	6.38

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001738	3129928	MAG	Sweden	Europe

• Gene Location: Start: 102134; End: 104140 Strand: -

Full Sequence      

MRNISAKATALFFSISLSFATSAREISYDGWKVSVNDRTGGVSMSHNGKTLISGSVAEWC
AGGDTLTMADCRNLRVTVSDGTGMFGPQKRISLSGKAGKTDVVQDIFLYPGKDFAATRLE
LSSRDGVSSRYMAPVSVTAPYDLFSRTGNSVIFVPYDNDAWVRYRITPFGQQAPESYEVS
AIINADTREGLVIGSLEHDTWKTGVKVSTDSTCGIDTLRAYGGIATNLTRDIIPHGKVTG
RTVKSPLMMVGLFDDWRDGMESFADACATVAPKIASRGGRPFGWNSWGKLQTKINYDKAT
EVSDFIHVNLQPASFENDGVTYIGLDAFWDFGFKPEQHKEFVARCRRNGQKAGIYYCPFT
DWGKNPDATIGEMPQYKFKDAYLYGDGKILEFDGAYALDPTHPAVQARIRRQLDEFKEWG
YEYVKIDFMAHGAYESDSHFDPSVTTGVQAYSRGMQYIDSVADGKLWINLSIAPLFPANY
AHSRRIGCDAWADINNTEYTLNALTYGWWLDRVYHYNDADHIVLEGVSDGENRARVTSSA
ITGVYLLGDDMSLGGDDAVKARIRRNITNPAINRMARECKSFRPVEPGRGDRAADAFCHT
TPECMYVAMFNFADKGALKTIPLRRLGLSEGRKYTATELWSADNMELDGDIAIEIPAKDV
KVLKINLK

Enzyme Prediction     

No EC number prediction in MGYG000001738_00302.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14791	GH36	3.66e-18	280	565	2	296	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
cd14792	GH27	5.15e-11	281	574	2	270	glycosyl hydrolase family 27 (GH27). GH27 enzymes occur in eukaryotes, prokaryotes, and archaea with a wide range of hydrolytic activities, including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-N-acetylgalactosaminidase, and 3-alpha-isomalto-dextranase. All GH27 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH27 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
pfam17801	Melibiase_C	1.42e-08	605	665	16	74	Alpha galactosidase C-terminal beta sandwich domain. This domain is found at the C-terminus of alpha galactosidase enzymes.
COG3345	GalA	3.47e-04	280	510	292	559	Alpha-galactosidase [Carbohydrate transport and metabolism].
cd06592	GH31_NET37	0.005	284	453	5	179	glucosidase NET37. NET37 (also known as KIAA1161) is a human lamina-associated nuclear envelope transmembrane protein. A member of the glycosyl hydrolase family 31 (GH31) , it has been shown to be required for myogenic differentiation of C2C12 cells. Related proteins are found in eukaryotes and prokaryotes. Enzymes of the GH31 family possess a wide range of different hydrolytic activities including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQA08702.1	5.58e-200	11	664	22	671
ALJ44661.1	1.58e-199	11	664	20	671
BCA52469.1	3.73e-199	11	664	6	655
QUT73244.1	6.35e-199	11	664	22	671
AAO78239.1	2.12e-198	11	664	4	655

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000316	0.998998	0.000176	0.000170	0.000160	0.000142

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001738_00302.