CAZyme Information: MGYG000001738_00514

Basic Information

• Species: Duncaniella sp001701225
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; Duncaniella; Duncaniella sp001701225
• CAZyme ID: MGYG000001738_00514
• CAZy Family: PL10
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
342		38934.87	6.2826

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001738	3129928	MAG	Sweden	Europe

• Gene Location: Start: 63760; End: 64788 Strand: -

Full Sequence      

MAARVPDLLKHQPKGFFKTEEAVRVGHQVVAYQRVTGGWPKNINMSVPMTPQQLDSVKAE
KWRRDDSTTDNGATNREMHFLAKLYQATGDTIWLEPFRRGVEYLLSGQYPGGGWPQFWPE
NHGYQVHITYNDNAMVNTLNILRDISASVAPYTDMIDKATALRIDSAFAKGIECILATQI
RDADGNLTVWCQQHDRETLLPAPARSYELPSYCSSESAGIVRLLMSLPAPDARVREAVHG
AMRWFDTHKLTGVRLERHYGDGGDTRLVSDPDEPLPIWARFYDLEKGEPYVCDRDGVPRK
SLEEIGHERRNGYGWYNRAPLDLYPLYAEWCALYDPEHTPKP

Enzyme Prediction     

No EC number prediction in MGYG000001738_00514.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL10	33	321	4.7e-110	0.9895833333333334

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam09492	Pec_lyase	8.03e-143	33	320	1	285	Pectic acid lyase. Members of this family are isozymes of pectate lyase (EC:4.2.2.2), also called polygalacturonic transeliminase and alpha-1,4-D-endopolygalacturonic acid lyase.
TIGR02474	pec_lyase	3.65e-114	33	320	1	286	pectate lyase, PelA/Pel-15E family. Members of this family are isozymes of pectate lyase (EC 4.2.2.2), also called polygalacturonic transeliminase and alpha-1,4-D-endopolygalacturonic acid lyase. [Energy metabolism, Biosynthesis and degradation of polysaccharides]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCD41704.1	4.40e-153	9	337	31	361
ALJ61703.1	2.63e-149	1	338	27	367
QUT92735.1	3.25e-148	1	338	27	367
QUT60181.1	4.63e-143	8	338	42	373
AII66180.1	4.63e-143	8	338	42	373

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1R76_A	9.71e-53	12	330	73	404	ChainA, pectate lyase [Niveispirillum irakense]
1GXM_A	2.49e-51	29	315	40	314	Family10 polysaccharide lyase from Cellvibrio cellulosa [Cellvibrio japonicus],1GXM_B Family 10 polysaccharide lyase from Cellvibrio cellulosa [Cellvibrio japonicus],1GXN_A Family 10 polysaccharide lyase from Cellvibrio cellulosa [Cellvibrio japonicus]
1GXO_A	3.79e-50	29	315	40	314	MutantD189A of Family 10 polysaccharide lyase from Cellvibrio cellulosa in complex with trigalaturonic acid [Cellvibrio japonicus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000056	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001738_00514.