CAZyme Information: MGYG000001738_01430

Basic Information

• Species: Duncaniella sp001701225
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; Duncaniella; Duncaniella sp001701225
• CAZyme ID: MGYG000001738_01430
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1281	MGYG000001738_14|CGC1	141859.23	6.6215

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001738	3129928	MAG	Sweden	Europe

• Gene Location: Start: 43032; End: 46877 Strand: +

Full Sequence      

MKSVRLTPILSLMTPLTLSAAVTDMRVENLVSPLGVGTSEPRFSWRVDAPAASQDSYRIL
VASSPELLAAGTPDLWDSGTVTSTAQQGIRYAGKPLRPATRAWWTVCATTGKEEHRPEHA
AEFGVGLLAESQWGGRWMGLETPREGDARGTVHTVLPARYMRKEFSIGTTPVRRATAYIS
GLGNYHLYVNGAEIGSGDVLKPVPSDYRKTVYYNTYDIPASMLGDSTLTVGIVLGPGRYF
PMRQHKAAKIPVFGNPTCRLNLIVEYADGSRRKLVTDDSWRVTDLGPIRLANEYDGEVYD
ARMEMPGWTASGFDDSAWLPAQRSAVPYGTLRAQTTPNMTCGESVSPLSVTPHGDRHIVD
FGVNMAGWIALRPRGAEGDTIRIRFAERLNPDGTLYTANLRDARSEDIYICSDRELGEVT
WTPSFTYHGFRYAEVSGLPGMGPDDISAIHVGDPMEMSMDFECSDTILNRVVRNALRGIR
ANYKGMPVDCPQRNERQPWLGDRTSGALGESMFFDNHTLYAKWVRDICEAQREDGCIPDV
APAFWNYYTDNVTWPAALPMVCDMLIEQYADTVPARMAYPHIARWMEHIIAEYSRDGIVT
RDRYGDWCVPPESPELIHSKDPARKTDGALISTAYTARCLALLEKFATMQGLGDDAARWR
TLREKTSEAFNRRFLTNRPGTTPKPGHPLYPDSIFYGTNTPTANVLALAFGLVPDSLRHA
VAENLAARIITEGNTHITTGVIGTSWLLRTLTANGRGDLAWTLATNRTYPSWGYMAEKGA
TTTWELWNGDTANPAMNSGNHVMLLGDLLSWVQQDLCGIRNGSQPGRYVFEADWSIPDCE
YASTSRPTPWGKIQSRWERDGRRLTWRITLPSGTSGEVRLPDGSVSEIGPGTHTVGCELP
LPHPLVTDAAHLYTRTSFPQCHAATIVETRDGDLVAAYFGGTHERHPDVCIWVSRKPKGS
DRWSDPILAGDGVFLPGTPDALLAGVNDSTTPASVGPIAQFADADPRLRRKACWNPVLTE
MPSGELWLFYKVGLRVADWTGWVVKSKDGGKTWSKREPLPQGFIGPVKNKPEIVDGRLIC
ASSTESGGWKLHFEILDLATGQWDYIDPIPADSAYLTEDLLPDGITPREGARLRPINCIQ
PSILRHDDGRLQVLMRTRNGRLATSWSDDRGRTWSRVTLTDIPNNQSGTDAVTLADGTHL
LIYNPFSTLPATKKGPRTPLAVARSTDGLHWTPIVTLEDSPISQYSYPAIIQGRDGDIHC
IYTWRRQRIAYRRLTLPDTTF

Enzyme Prediction     

No EC number prediction in MGYG000001738_01430.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	353	880	2.2e-147	0.9880952380952381
CBM67	158	325	1e-31	0.8693181818181818
GH33	915	1263	5.6e-30	0.9093567251461988

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	1.83e-120	461	811	6	335	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam13088	BNR_2	3.80e-86	932	1260	1	280	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
pfam08531	Bac_rhamnosid_N	3.90e-50	171	339	2	168	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
cd15482	Sialidase_non-viral	2.06e-37	916	1275	9	339	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
pfam05592	Bac_rhamnosid	1.97e-35	355	451	6	101	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS84864.1	0.0	22	1276	8	1267
QIU95828.1	0.0	22	1274	26	1283
QUR43127.1	0.0	22	1274	24	1281
QUT92130.1	0.0	22	1276	25	1284
QUT29077.1	0.0	22	1274	24	1281

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I60_A	1.18e-143	24	881	34	899	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
3W5M_A	6.10e-110	22	893	6	1026	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	6.43e-88	21	893	3	861	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KNB2	3.12e-120	28	881	42	879	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
Q82PP4	2.60e-109	22	893	6	1026	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
P9WF03	9.34e-109	23	881	32	879	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
T2KPL4	1.40e-96	32	888	42	914	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001353	0.997719	0.000225	0.000264	0.000216	0.000201

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001738_01430.