CAZyme Information: MGYG000001738_02266

Basic Information

• Species: Duncaniella sp001701225
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; Duncaniella; Duncaniella sp001701225
• CAZyme ID: MGYG000001738_02266
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
431	MGYG000001738_33|CGC1	46677.59	6.1147

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001738	3129928	MAG	Sweden	Europe

• Gene Location: Start: 15689; End: 16984 Strand: -

Full Sequence      

MKRLLLPAFVMAALSVSAAGPYDSIVAADGTGDFRTVSEAIAAAPEGSTRPWKILVKNGD
YDELIEIPETKPNIHLIGQDRGRTVIHHLVNQGGKAQENSRFDKTIYWQSSVHNPESPTY
GKGPAVVMVKAPGFYAEDITFTNDWGVDATSGPQALAMHTNADRSALNGCVLRGFQDTWR
TANEDTCRTYARDCRIEGAVDYMYGGGDALVENSVFYNVRGGSVIVAPSHGPDVKWGYVL
DGCTVDGNAEAADGKLKLGRPWKGAPKVLWLNTTLLIPILPEGWGDMGTIPAMMADHGTR
DRLGKPDDTSARKTLYKVRDRKTGEVTEGTARASVTDAEAARYTYDAIIRPAEGWDPAAM
MTRLPAPTELKYENGTLSWQPVEGAAGYIVYDGDHIITATEATSLSVPQIKTSLKVRAVN
PWGAKGKQTFN

Enzyme Prediction     

No EC number prediction in MGYG000001738_02266.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	25	288	1.7e-64	0.8333333333333334

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01095	Pectinesterase	1.71e-44	23	284	1	242	Pectinesterase.
PLN02506	PLN02506	3.21e-32	23	284	233	465	putative pectinesterase/pectinesterase inhibitor
PLN02773	PLN02773	1.38e-30	26	288	9	250	pectinesterase
PLN02708	PLN02708	1.43e-30	12	284	231	493	Probable pectinesterase/pectinesterase inhibitor
PLN02432	PLN02432	1.55e-30	26	288	15	240	putative pectinesterase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDM11324.1	4.45e-152	1	428	1	431
SCV07880.1	4.45e-152	1	428	1	431
QUT78463.1	4.45e-152	1	428	1	431
ALJ48470.1	4.45e-152	1	428	1	431
QRQ55307.1	4.45e-152	1	428	1	431

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1GQ8_A	3.00e-24	17	284	3	249	Pectinmethylesterase from Carrot [Daucus carota]
2NSP_A	7.20e-21	34	349	18	334	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]
1XG2_A	6.02e-20	23	286	4	247	ChainA, Pectinesterase 1 [Solanum lycopersicum]
3UW0_A	9.64e-18	2	262	11	269	Pectinmethylesterase from Yersinia enterocolitica [Yersinia enterocolitica subsp. enterocolitica 8081]
5C1E_A	7.12e-17	26	287	13	248	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9M9W7	5.99e-28	23	323	240	514	Putative pectinesterase/pectinesterase inhibitor 22 OS=Arabidopsis thaliana OX=3702 GN=PME22 PE=3 SV=1
Q43062	1.49e-26	23	284	208	450	Pectinesterase/pectinesterase inhibitor PPE8B OS=Prunus persica OX=3760 PE=2 SV=1
Q43043	2.03e-26	14	284	50	299	Pectinesterase OS=Petunia integrifolia OX=4103 GN=PPE1 PE=2 SV=1
Q42534	2.50e-24	23	284	276	517	Pectinesterase 2 OS=Arabidopsis thaliana OX=3702 GN=PME2 PE=2 SV=2
Q1JPL7	3.01e-24	25	325	248	532	Pectinesterase/pectinesterase inhibitor 18 OS=Arabidopsis thaliana OX=3702 GN=PME18 PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000397	0.998845	0.000208	0.000174	0.000174	0.000156

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001738_02266.