CAZyme Information: MGYG000001738_02583

Basic Information

• Species: Duncaniella sp001701225
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; Duncaniella; Duncaniella sp001701225
• CAZyme ID: MGYG000001738_02583
• CAZy Family: GH97
• CAZyme Description: Glucan 1,4-alpha-glucosidase SusB

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
722		81712.25	5.0268

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001738	3129928	MAG	Sweden	Europe

• Gene Location: Start: 198; End: 2366 Strand: +

Full Sequence      

MFKEILLTTAFLSIGAVAGASESVASPDGDIRLTFELTDGGVPTYYVDFKGKQVIAPSHL
GFDLVSESGRNSFEHQAKKAAADALSLRDGFAVVKTVRDSLSETWTPVWGEEAEILNRYN
SMTVQLDQTRFDRKMNIEFRVFDDGFAFRYDFPAQPNLNYFVIGEEKSEFAMPGDLWAYW
IPGDYDTQEYNYTKSRLSEIRGLFPSKINPDNASTTPFSPTGVQTSLQLKSDDGVYMNIH
EAGTIDYPTMHLNLNDTTMVFTSWLTPDSQGRKGYMQTPVATPWRYVLVTDDARDILASR
MAYNLNEPSKIEDTSWIKPVKYIGVWWEMITGAGSWNYTDDVYSVKLGETDYSKTKPNGR
HSANNEKVKRYIDFAAEHGFDQVLVEGWNEGWEDWFGQSKDYVFDFVTPYPDFDLKALNE
YAHSKGVKLMMHHETSGSVRNYERHLEDAYRLMEENGYNAVKSGYVGNMIPRGEYHYSQW
LNNHYNYAVRKAAEHKIMVNAHEATRPTGLARTYPNLIGNESARGTEYQAMGGNDKSHTS
ILPFTRLQGGPMDYTPGIFEFDLSTFTPSNNSKIASTIPGQLALYVTMYSPLQMAADLPE
HYEKHLDAFQFIKDVPVEWERSVYLEAEPMEYVTIARKDKNSDEWYVGSTAGTADRESVI
KLGFLDPGRKYEATIYAEAPDANTVDGQQRYVITKKKVNSKTTLKNHALAGGGYAISIKP
ID

Enzyme Prediction     

EC	3.2.1.3	3.2.1.20

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH97	16	718	1.3e-236	0.9841521394611727

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam10566	Glyco_hydro_97	1.69e-138	313	616	1	278	Glycoside hydrolase 97. This domain is the catalytic region of the bacterial glycosyl-hydrolase family 97. This central part of the GH97 family protein sequences represents a typical and complete (beta/alpha)8-barrel or catalytic TIM-barrel type domain. The N- and C-terminal parts of the sequences, mainly consisting of beta-strands, form two additional non-catalytic domains. In all known glycosidases with the (beta-alpha)8-barrel fold, the amino acid residues at the active site are located on the C-termini of the beta-strands.
pfam14508	GH97_N	1.74e-86	26	308	1	235	Glycosyl-hydrolase 97 N-terminal. This N-terminal domain of glycosyl-hydrolase-97 contributes part of the active site pocket. It is also important for contact with the catalytic and C-terminal domains of the whole.
pfam14509	GH97_C	2.17e-35	619	719	1	97	Glycosyl-hydrolase 97 C-terminal, oligomerization. Glycosyl-hydrolase-97 is made up of three tightly linked and highly conserved globular domains. The C-terminal domain is found to be necessary for oligomerization of the whole molecule in order to create the active-site pocket and the Ca++-binding site.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCD41705.1	0.0	11	722	6	722
QCP72455.1	0.0	1	721	1	721
QCD38766.1	0.0	1	721	1	721
ALA72849.1	0.0	3	721	4	726
QJR61692.1	0.0	3	721	4	726

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2D73_A	0.0	22	721	23	726	CrystalStructure Analysis of SusB [Bacteroides thetaiotaomicron VPI-5482],2D73_B Crystal Structure Analysis of SusB [Bacteroides thetaiotaomicron VPI-5482],2ZQ0_A Crystal structure of SusB complexed with acarbose [Bacteroides thetaiotaomicron],2ZQ0_B Crystal structure of SusB complexed with acarbose [Bacteroides thetaiotaomicron]
2JKA_A	0.0	24	721	14	715	Nativestructure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JKA_B Native structure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JKE_A Structure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron in complex with deoxynojirimycin [Bacteroides thetaiotaomicron VPI-5482],2JKE_B Structure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron in complex with deoxynojirimycin [Bacteroides thetaiotaomicron VPI-5482],2JKP_A Structure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron in complex with castanospermine [Bacteroides thetaiotaomicron VPI-5482],2JKP_B Structure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron in complex with castanospermine [Bacteroides thetaiotaomicron VPI-5482]
3WFA_A	0.0	22	721	3	706	Catalyticrole of the calcium ion in GH97 inverting glycoside hydrolase [Bacteroides thetaiotaomicron],3WFA_B Catalytic role of the calcium ion in GH97 inverting glycoside hydrolase [Bacteroides thetaiotaomicron]
5HQ4_A	4.70e-150	23	721	2	661	AGlycoside Hydrolase Family 97 enzyme from Pseudoalteromonas sp. strain K8 [Pseudoalteromonas sp. K8],5HQA_A A Glycoside Hydrolase Family 97 enzyme in complex with Acarbose from Pseudoalteromonas sp. strain K8 [Pseudoalteromonas sp. K8]
5HQC_A	4.70e-150	23	721	2	661	AGlycoside Hydrolase Family 97 enzyme R171K variant from Pseudoalteromonas sp. strain K8 [Pseudoalteromonas sp. K8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
G8JZS4	0.0	3	721	4	726	Glucan 1,4-alpha-glucosidase SusB OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=susB PE=1 SV=1
Q8A6L0	2.37e-67	6	719	7	662	Retaining alpha-galactosidase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_1871 PE=1 SV=1
D7CFN7	1.02e-34	1	715	13	617	Probable retaining alpha-galactosidase OS=Streptomyces bingchenggensis (strain BCW-1) OX=749414 GN=SBI_01652 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000604	0.998472	0.000257	0.000232	0.000208	0.000199

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001738_02583.