CAZyme Information: MGYG000001739_00607

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; TANB77; CAG-508; CAG-269
• CAZyme ID: MGYG000001739_00607
• CAZy Family: GT28
• CAZyme Description: Processive diacylglycerol beta-glucosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
99		11037.87	9.0272

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001739	1375923	MAG	Sweden	Europe

• Gene Location: Start: 5919; End: 6218 Strand: +

Full Sequence      

MAISDLVITKPGGLTSTEALVSNLPIIAINPIPGQEEDNARFLEHNNVGIWLKKSSYLTF
VLKKLLNNETKLQSMKENTKQIAKPNSTKDICNILFKEI

Enzyme Prediction     

No EC number prediction in MGYG000001739_00607.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT28	1	86	1.7e-20	0.5859872611464968

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd17507	GT28_Beta-DGS-like	6.14e-36	1	99	265	363	beta-diglucosyldiacylglycerol synthase and similar proteins. beta-diglucosyldiacylglycerol synthase (processive diacylglycerol beta-glucosyltransferase EC 2.4.1.315) is involved in the biosynthesis of both the bilayer- and non-bilayer-forming membrane glucolipids. This family of glycosyltransferases also contains plant major galactolipid synthase (chloroplastic monogalactosyldiacylglycerol synthase 1 EC 2.4.1.46). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. The structures of the formed glycoconjugates are extremely diverse, reflecting a wide range of biological functions. The members of this family share a common GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
COG0707	MurG	1.21e-22	1	99	250	355	UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
PRK13609	PRK13609	4.26e-21	1	99	271	369	diacylglycerol glucosyltransferase; Provisional
PRK13608	PRK13608	2.44e-18	1	95	271	365	diacylglycerol glucosyltransferase; Provisional
cd03785	GT28_MurG	1.57e-14	1	94	250	350	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. MurG (EC 2.4.1.227) is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis. It transfers N-acetyl-D-glucosamine (GlcNAc) from UDP-GlcNAc to the C4 hydroxyl of a lipid-linked N-acetylmuramoyl pentapeptide (NAM). The resulting disaccharide is then transported across the cell membrane, where it is polymerized into NAG-NAM cell-wall repeat structure. MurG belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains, each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SNV64431.1	4.99e-23	1	99	273	371
CDM68160.1	1.53e-22	1	99	271	369
ADZ21941.1	1.77e-22	1	99	271	369
AAK80839.1	1.77e-22	1	99	271	369
AWV78749.1	1.77e-22	1	99	271	369

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WYI_A	2.83e-06	1	85	285	370	Thecrystal structure of Arabidopsis thaliana galactolipid synthase, MGD1 (apo-form) [Arabidopsis thaliana],4X1T_A The crystal structure of Arabidopsis thaliana galactolipid synthase MGD1 in complex with UDP [Arabidopsis thaliana]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A8FED1	4.58e-15	3	98	273	368	Processive diacylglycerol beta-glucosyltransferase OS=Bacillus pumilus (strain SAFR-032) OX=315750 GN=ugtP PE=3 SV=1
P54166	8.61e-15	3	98	273	368	Processive diacylglycerol beta-glucosyltransferase OS=Bacillus subtilis (strain 168) OX=224308 GN=ugtP PE=1 SV=1
Q65IA4	1.63e-14	3	98	273	368	Processive diacylglycerol beta-glucosyltransferase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46) OX=279010 GN=ugtP PE=3 SV=1
A0R9F0	3.85e-13	3	98	273	368	Processive diacylglycerol beta-glucosyltransferase OS=Bacillus thuringiensis (strain Al Hakam) OX=412694 GN=ugtP PE=3 SV=1
Q73DZ5	7.22e-13	3	98	273	368	Processive diacylglycerol beta-glucosyltransferase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) OX=222523 GN=ugtP PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000031	0.000008	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001739_00607.