CAZyme Information: MGYG000001739_00728

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; TANB77; CAG-508; CAG-269
• CAZyme ID: MGYG000001739_00728
• CAZy Family: GT2
• CAZyme Description: Beta-monoglucosyldiacylglycerol synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
409		47744.03	8.9725

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001739	1375923	MAG	Sweden	Europe

• Gene Location: Start: 38347; End: 39576 Strand: +

Full Sequence      

MEYIYLLRQALVYIIVVFWIYELAISLCALIKFKEKPLLKKKNHKFMAIIPAHNEETVIA
NLVESLKNQDYDKDLYDIYVIADNCTDNTAKYAKEAGAIVYKRFDETKKTKGYALNWFLK
QKIEENADYDAFLVFDADNIVDKNFIKVMNRKLCQGEEVVQGYKDIKNPAESWVSAGYAF
FYWTMHRFYHLARYNVGLSPLLNGTGFMVKFDLVKENGWDTKTLTEDIEFSLKQIIKGKK
LGWATDAIVYDEQPEKFKASWTQRTRWTVGHIQCMKIYTKDLAKAVEKNKTIMNFDGLLY
IVGSIPMFVASMVLLLSNFVIYALDTMTGAQLLINIIRYVVPTFFLPILSALFTMYLDKK
PIKPMLKWALYYPLFMGSWLLINFKCLFKQDTTWEKIDHVRSVDIKEIA

Enzyme Prediction     

No EC number prediction in MGYG000001739_00728.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	46	270	2.4e-28	0.9826086956521739

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06438	EpsO_like	4.38e-88	49	230	2	183	EpsO protein participates in the methanolan synthesis. The Methylobacillus sp EpsO protein is predicted to participate in the methanolan synthesis. Methanolan is an exopolysaccharide (EPS), composed of glucose, mannose and galactose. A 21 genes cluster was predicted to participate in the methanolan synthesis. Gene disruption analysis revealed that EpsO is one of the glycosyltransferase enzymes involved in the synthesis of repeating sugar units onto the lipid carrier.
cd06423	CESA_like	1.05e-49	49	227	2	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
COG1215	BcsA	9.72e-45	4	389	8	399	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd06421	CESA_CelA_like	9.65e-25	45	273	2	232	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.
pfam13641	Glyco_tranf_2_3	1.38e-22	46	267	4	227	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QWT55360.1	2.42e-106	20	409	23	414
BCI60981.1	5.67e-106	18	408	22	413
CDZ24461.1	6.39e-102	17	408	20	409
ACA55073.1	3.08e-96	9	408	13	420
ACA45844.1	3.08e-96	9	408	13	420

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P96587	8.37e-18	41	398	46	412	Uncharacterized glycosyltransferase YdaM OS=Bacillus subtilis (strain 168) OX=224308 GN=ydaM PE=3 SV=1
Q8YMK0	4.89e-10	49	273	111	336	Beta-monoglucosyldiacylglycerol synthase OS=Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576) OX=103690 GN=all4933 PE=1 SV=1
Q5HCN1	1.00e-09	49	270	52	270	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain COL) OX=93062 GN=icaA PE=3 SV=1
Q6G608	1.00e-09	49	270	52	270	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain MSSA476) OX=282459 GN=icaA PE=3 SV=1
Q6GDD8	1.00e-09	49	270	52	270	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain MRSA252) OX=282458 GN=icaA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000014	0.000015	0.000001	0.000000	0.000000	0.000002

TMHMM  Annotations     

start	end
12	31
298	320
332	354
369	388