CAZyme Information: MGYG000001745_01532

Basic Information

• Species: Coprococcus sp900548215
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Coprococcus; Coprococcus sp900548215
• CAZyme ID: MGYG000001745_01532
• CAZy Family: GH5
• CAZyme Description: Endoglucanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
345		39585.67	4.4909

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001745	2913085	MAG	Sweden	Europe

• Gene Location: Start: 117210; End: 118247 Strand: +

Full Sequence      

MKRQLRIILIVIIAAVAATAVIFAVKYIKNGGEFLTPVGTRAEFIGDTKKYPSELLTKGN
AIYDSDGEKVMLRGVEVPESHELYKEKRFKEDFYDGVFKLGGNAIRVPVSPAEYKRDDYY
LWRYLDRIVAWAGENGNYVIIDWDYTGNPIDGTGDEMPDIKDNPLDYSAEFWKAVATYFK
NVPNVIYEIYNEPVGMSDSEWKRCADSLVSVIRDAGSKQLIIVGSPDYCYDLGWLDELGV
DDDNIAFSMHVYPDRVFWQKYMPEYVSSYPVIVTEWGYADDDVEAENEKMNGTKNVFGIK
FSHFMDKHESSWIASSYNYKGDTPMFEKNFKGKTKWGEFVSELLE

Enzyme Prediction     

No EC number prediction in MGYG000001745_01532.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	62	334	6.8e-42	0.8945454545454545

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	2.34e-36	63	321	1	272	Cellulase (glycosyl hydrolase family 5).
COG2730	BglC	1.16e-08	30	253	22	257	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBK83512.1	1.18e-188	1	344	1	345
QTA37905.1	6.09e-89	2	345	3	350
AEW47956.1	5.66e-69	51	340	55	346
AZR73456.1	5.29e-54	139	345	1	209
QFU77336.1	2.92e-33	55	344	73	386

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4HTY_A	2.78e-28	58	314	55	323	CrystalStructure of a metagenome-derived cellulase Cel5A [uncultured bacterium],4HU0_A Crystal Structure of a metagenome-derived cellulase Cel5A in complex with cellotetraose [uncultured bacterium]
3PZT_A	1.35e-17	28	334	15	305	Structureof the endo-1,4-beta-glucanase from Bacillus subtilis 168 with manganese(II) ion [Bacillus subtilis subsp. subtilis str. 168],3PZT_B Structure of the endo-1,4-beta-glucanase from Bacillus subtilis 168 with manganese(II) ion [Bacillus subtilis subsp. subtilis str. 168],3PZU_A P212121 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168],3PZU_B P212121 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168],3PZV_A C2 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168],3PZV_B C2 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168],3PZV_C C2 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168],3PZV_D C2 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168]
5ECU_A	4.38e-15	64	323	40	298	Theunliganded structure of Caldicellulosiruptor saccharolyticus GH5 [Caldicellulosiruptor saccharolyticus]
1EGZ_A	3.64e-14	125	345	79	285	ChainA, ENDOGLUCANASE Z [Dickeya chrysanthemi],1EGZ_B Chain B, ENDOGLUCANASE Z [Dickeya chrysanthemi],1EGZ_C Chain C, ENDOGLUCANASE Z [Dickeya chrysanthemi]
5WH8_A	2.20e-13	46	323	5	279	CellulaseCel5C_n [uncultured organism]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P22541	1.41e-17	50	289	111	349	Endoglucanase A OS=Butyrivibrio fibrisolvens OX=831 GN=celA PE=1 SV=1
P07983	1.97e-16	54	334	41	310	Endoglucanase OS=Bacillus subtilis OX=1423 GN=bglC PE=3 SV=2
P10475	2.65e-16	54	334	41	310	Endoglucanase OS=Bacillus subtilis (strain 168) OX=224308 GN=eglS PE=1 SV=1
P23549	1.56e-15	54	334	41	310	Endoglucanase OS=Bacillus subtilis OX=1423 GN=bglC PE=3 SV=1
P07103	4.63e-13	125	345	122	328	Endoglucanase Z OS=Dickeya dadantii (strain 3937) OX=198628 GN=celZ PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.919050	0.075476	0.001991	0.000492	0.000274	0.002747

TMHMM  Annotations     

start	end
7	25