CAZyme Information: MGYG000001748_00121

Basic Information

• Species: CAG-56 sp900762665
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; CAG-56; CAG-56 sp900762665
• CAZyme ID: MGYG000001748_00121
• CAZy Family: GH141
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
967		107315.59	7.4205

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001748	4218051	MAG	Sweden	Europe

• Gene Location: Start: 139239; End: 142142 Strand: +

Full Sequence      

MKKRIVSLLTILSLLCGMIPSDVLANDIKGSSVPEIMFFVSPDGSDSNSGSFRQPFETLE
RAKEEVSKYNRHMSSDIYVYLRGGTYWLDETLKFTERDSGSNGFQVKYAAFEDEVPVISG
GKQIDGWQLHDSEKNIYKASGIDFDFRQLYVDGHKAIRAQTGVPGEYSTRIVGADRLDAQ
GVMPEWVTGSSTDGRVGDQATSGQIHIKNSDEGVMGLSEYGNIDDLSNPVEICVLTAWAE
NILRIDSLEKGSVNSTLKIMEPEAQRVFNRPHPNIDLYSHVHTREFAYHLENAYEFITDD
NEWFLDKSAETLYYKAPAGKDMEQAEMIAPALETLLSVEGSLDAPVRDIQFHGLTFQHSN
WTAPSQEGLVGGQAQQNVVSSIFRTNYVVVKRPPAGVCVSGAHNLRFEGNTFRNMGATAF
DLHWGTKNTVFINNTVKDISGNGISVGKFAINDTDADYHELYNPEDVRDICTDDKILNNY
VCWIGTDYEGAVAIGAGLPKNVMIADNTVAYVPYSGISVGFGWRNEPNAMSGNQILRNEI
HHNSQIMCDAGAIYTLSRQPGSYCMGNYIHDVIEPAWKDYGNNAMYFDEGTQGYTIRNNV
ITGNQTWIGFNQTGSNTVDSNHVNPDNSNWEAQQIIKNAGVKEDYTETGTPQPAPSVPEK
RGLKQAIDSAGRKVQAVYDTKSWNHLQQVLTNARDIYEKVSFTQEELDKVENDLKTAIAH
LAYLASEPETFRVTFANGGGSGSLPGNITAKAGTRINLPDSTLSRSGFSFAGWSDGLRVY
QAQAHFVMPKRDVLLTAQWQEVGARSFTVQFDTNGGTKIANQQIAEGGKVAKPADPAKKG
YVFTGWKNGSSQYDFSSKVAGDLKLSAVWEKVKVAKAAILKISNKKNGRAQVKIKKIAKA
EGYQIQYALDRKFKKGKKQVVTQSCIKIIKRLKKGKTYYFKVRSYKRDSLGYKVYGIYSK
PKKIRMK

Enzyme Prediction     

No EC number prediction in MGYG000001748_00121.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH141	38	603	1.3e-150	0.9905123339658444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam09479	Flg_new	1.18e-14	807	868	1	65	Listeria-Bacteroides repeat domain (List_Bact_rpt). This model describes a conserved core region of about 43 residues, which occurs in at least two families of tandem repeats. These include 78-residue repeats which occur from 2 to 15 times in some proteins of Bacteroides forsythus ATCC 43037, and 70-residue repeats found in families of internalins of Listeria species. Single copies are found in proteins of Fibrobacter succinogenes, Geobacter sulfurreducens, and a few other bacteria.
NF033188	internalin_H	6.59e-10	713	871	308	482	InlH/InlC2 family class 1 internalin. Internalins, as found in the intracellular human pathogen Listeria monocytogenes, are paralogous surface or secreted proteins with an N-terminal signal peptide, leucine-rich repeats, and usually a C-terminal LPXTG processing and cell surface anchoring site. See PMID:17764999 for a general discussion of internalins. Members of this family are internalin H (InlH), or internalin C2, two class 1 (LPXTG-type) internalins that are closely related, one apparently derived from the other through a recombination event.
NF033189	internalin_A	2.04e-08	764	875	595	708	class 1 internalin InlA. Internalins, as found in the intracellular human pathogen Listeria monocytogenes, are paralogous surface or secreted proteins with an N-terminal signal peptide, leucine-rich repeats, and usually a C-terminal LPXTG processing and cell surface anchoring site. See PMID:17764999 for a general discussion of internalins. Members of this family are internalin A (InlA), a class 1 (LPXTG-type) internalin.
NF033189	internalin_A	1.05e-06	751	857	513	618	class 1 internalin InlA. Internalins, as found in the intracellular human pathogen Listeria monocytogenes, are paralogous surface or secreted proteins with an N-terminal signal peptide, leucine-rich repeats, and usually a C-terminal LPXTG processing and cell surface anchoring site. See PMID:17764999 for a general discussion of internalins. Members of this family are internalin A (InlA), a class 1 (LPXTG-type) internalin.
pfam13229	Beta_helix	1.68e-04	395	621	1	156	Right handed beta helix region. This region contains a parallel beta helix region that shares some similarity with Pectate lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADL27132.1	2.53e-124	31	649	23	614
ACX75367.1	2.53e-124	31	649	23	614
QDN84965.1	1.47e-108	38	645	37	602
QDO17263.1	1.47e-108	38	645	37	602
QDO05834.1	1.47e-108	38	645	37	602

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MQP_A	1.81e-76	39	647	28	621	Glycosidehydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_B Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_C Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_D Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_E Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_F Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_G Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_H Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0DJ97	1.26e-10	741	870	524	659	Putative Gly-rich membrane protein Bcell_0380 OS=Evansella cellulosilytica (strain ATCC 21833 / DSM 2522 / FERM P-1141 / JCM 9156 / N-4) OX=649639 GN=Bcell_0380 PE=4 SV=1
P0DJ98	5.90e-08	723	870	4	150	Putative membrane protein Bcell_0381 OS=Evansella cellulosilytica (strain ATCC 21833 / DSM 2522 / FERM P-1141 / JCM 9156 / N-4) OX=649639 GN=Bcell_0381 PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000324	0.997736	0.001339	0.000201	0.000184	0.000160

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001748_00121.