CAZyme Information: MGYG000001748_00606

Basic Information

• Species: CAG-56 sp900762665
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; CAG-56; CAG-56 sp900762665
• CAZyme ID: MGYG000001748_00606
• CAZy Family: GH136
• CAZyme Description: Chromosome partition protein Smc

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1437		157134.64	4.6674

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001748	4218051	MAG	Sweden	Europe

• Gene Location: Start: 2561; End: 6874 Strand: +

Full Sequence      

MKWKKTMSLILAVSMTVPGIIGGLGKMPVQAAEEKVNEAERESYNLALDFAGGIQGPAWY
HEYQFTSGNDKGKRMQYEEWIEDWNCFIALEGVLTSGMENGMGLIAPAPTADSLAVWEAP
RDGVVEVSMAHQAYLRRQYQTSGNVGVYIEKNGKKIYPASGEILLQAQSKMYLYPIPVQV
RTGDRIAVGLTSKKNLTDASVYITPVISYVEKEAVEKENAAVGANVTASSTADGYSVNGL
TDYILSEQHQQYEWKAKTAEQEWLDFGFESSKVSDIVLVDGSGGAYTGNIRCTFSDGTAV
EFASEQAAAKEGIRTFSLEAPVSASSVKIEFINTDGGIPVLGDIQILTVRREQGEEPGGE
AAEPGIYYVDSAAGSDSNDGKSEDGAWATLDKVNSMQFAPGTKILFKAGTTYKGALVLQG
SGTEEAPIIVDMYGEGPKPHIEGEGKVRHTVHLKNVNHVTVRNLEVSNNAAQRQLLSGVF
VEASGCGVMEDVHLDSLDVHDVYGTLDEKTLPNGGIYYEVTDESDDTRFNNISVQNCTVK
RVSRTGISVGMTESYELWDGHGGIIPDEVKEKYGHTNVVIRNNYVEEAGGDAIVPMFSIS
PLIEYNISNKASVNTKDQWTMYNAAIWPWRCEDAVFQFNEAYDTYENGDGQAYDCDWSRH
TTYQYNYSHNNKGGFILVCQNEALDSVIRYNVSQNDEDSLFLMSNPDNADVYNNTFYIGP
NLKKVVDSNGKATLKNNIFYCPEGIELPNNNWGSGFTYDTNLFYGFDTTPNDPNKILADP
MFADPGKGGTGTEPGKPALDSLGGYALQEDSPAINAGIRIPDNGGRDFAGNPVGETKPDL
GAFESDVEELMTLKEEEILVTDAGAVTKVETIVKEGAELEGGITYTSSDENVAAADETGR
ITFYGYGTAVINVSARINGKEVSLKCRVILKESDYESFSGQFENAYANTQDVQNPVSCLI
DGDLSSFWHTQWNGSGFELTQENPAILTLKLRDDAKAHNGFRFLQRPSNVNGLVQKFKYV
VGNTFDEALNQITDGVESPEIMVANPANGSWVNVDLPEGMDGKYIQIQILQGEGEFGAVA
EVETYNQIRYATAENNLILAQNKLEKTEKELKEALQTVEKLKEEASGNAEQIEALQKAVK
QAEEAAQKAEKARDELQKALDKVQAEKDEAEAELEKAKAEAEKAKVEAEKAKAEADKAKA
EAEKAEAEAKKAEAEAKKAREELEKAKTEADIARTEVEKAQAEAEKTEAEAEKARAEADK
AKAEADRANTEEKKAWAEAERLKKELEEVKKELELQKELKKGDSVTYKNVVYKVTDPSKK
TVAAVKGNDVSAITIAKSVKIKGITCTVTKIADKAFMNAKKLSRVTIGENVTTIGKQAFY
GARKLKSINIRTRKLTTVGKSAFAKIGKKAKISVPKSKKAKYSKQLKGKTSLDARIK

Enzyme Prediction     

No EC number prediction in MGYG000001748_00606.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH136	367	844	1.7e-147	0.9898167006109979

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
sd00036	LRR_3	3.56e-13	1347	1419	1	72	leucine-rich repeats. A leucine-rich repeat (LRR) is a structural protein motif of 20-30 amino acids that is unusually rich in the hydrophobic amino acid leucine. The conserved eleven-residue sequence motif (LxxLxLxxN/CxL) within the LRRs corresponds to the beta-strand and adjacent loop regions, whereas the remaining parts of the repeats are variable. LRRs fold together to form a solenoid protein domain, termed leucine-rich repeat domain. Leucine-rich repeats are usually involved in protein-protein interactions.
sd00036	LRR_3	1.90e-12	1344	1417	44	116	leucine-rich repeats. A leucine-rich repeat (LRR) is a structural protein motif of 20-30 amino acids that is unusually rich in the hydrophobic amino acid leucine. The conserved eleven-residue sequence motif (LxxLxLxxN/CxL) within the LRRs corresponds to the beta-strand and adjacent loop regions, whereas the remaining parts of the repeats are variable. LRRs fold together to form a solenoid protein domain, termed leucine-rich repeat domain. Leucine-rich repeats are usually involved in protein-protein interactions.
sd00036	LRR_3	4.27e-12	1337	1417	14	93	leucine-rich repeats. A leucine-rich repeat (LRR) is a structural protein motif of 20-30 amino acids that is unusually rich in the hydrophobic amino acid leucine. The conserved eleven-residue sequence motif (LxxLxLxxN/CxL) within the LRRs corresponds to the beta-strand and adjacent loop regions, whereas the remaining parts of the repeats are variable. LRRs fold together to form a solenoid protein domain, termed leucine-rich repeat domain. Leucine-rich repeats are usually involved in protein-protein interactions.
pfam13306	LRR_5	3.09e-11	1347	1417	21	89	Leucine rich repeats (6 copies). This family includes a number of leucine rich repeats. This family contains a large number of BSPA-like surface antigens from Trichomonas vaginalis.
sd00036	LRR_3	1.49e-10	1344	1404	67	126	leucine-rich repeats. A leucine-rich repeat (LRR) is a structural protein motif of 20-30 amino acids that is unusually rich in the hydrophobic amino acid leucine. The conserved eleven-residue sequence motif (LxxLxLxxN/CxL) within the LRRs corresponds to the beta-strand and adjacent loop regions, whereas the remaining parts of the repeats are variable. LRRs fold together to form a solenoid protein domain, termed leucine-rich repeat domain. Leucine-rich repeats are usually involved in protein-protein interactions.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUH27719.1	1.23e-132	367	913	36	568
QXJ59585.1	3.75e-105	344	844	12	599
BBH21553.1	8.09e-93	367	844	43	527
AXG37184.1	4.54e-92	357	844	25	619
QNK55089.1	7.81e-92	312	843	208	735

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7V6M_A	1.52e-89	360	845	4	577	ChainA, Fibronectin type III domain-containing protein [Tyzzerella nexilis]
7V6I_A	2.24e-77	367	845	16	609	ChainA, Lacto-N-biosidase [Bifidobacterium saguini DSM 23967]
5GQC_A	4.04e-77	353	848	6	600	Crystalstructure of lacto-N-biosidase LnbX from Bifidobacterium longum subsp. longum, ligand-free form [Bifidobacterium longum subsp. longum],5GQC_B Crystal structure of lacto-N-biosidase LnbX from Bifidobacterium longum subsp. longum, ligand-free form [Bifidobacterium longum subsp. longum],5GQC_C Crystal structure of lacto-N-biosidase LnbX from Bifidobacterium longum subsp. longum, ligand-free form [Bifidobacterium longum subsp. longum],5GQC_D Crystal structure of lacto-N-biosidase LnbX from Bifidobacterium longum subsp. longum, ligand-free form [Bifidobacterium longum subsp. longum],5GQC_E Crystal structure of lacto-N-biosidase LnbX from Bifidobacterium longum subsp. longum, ligand-free form [Bifidobacterium longum subsp. longum],5GQC_F Crystal structure of lacto-N-biosidase LnbX from Bifidobacterium longum subsp. longum, ligand-free form [Bifidobacterium longum subsp. longum],5GQC_G Crystal structure of lacto-N-biosidase LnbX from Bifidobacterium longum subsp. longum, ligand-free form [Bifidobacterium longum subsp. longum],5GQC_H Crystal structure of lacto-N-biosidase LnbX from Bifidobacterium longum subsp. longum, ligand-free form [Bifidobacterium longum subsp. longum],5GQF_A Crystal structure of lacto-N-biosidase LnbX from Bifidobacterium longum subsp. longum, lacto-N-biose complex [Bifidobacterium longum subsp. longum],5GQF_B Crystal structure of lacto-N-biosidase LnbX from Bifidobacterium longum subsp. longum, lacto-N-biose complex [Bifidobacterium longum subsp. longum],5GQG_A Crystal structure of lacto-N-biosidase LnbX from Bifidobacterium longum subsp. longum, galacto-N-biose complex [Bifidobacterium longum subsp. longum],5GQG_B Crystal structure of lacto-N-biosidase LnbX from Bifidobacterium longum subsp. longum, galacto-N-biose complex [Bifidobacterium longum subsp. longum]
6KQT_A	1.44e-66	367	717	247	638	CrystalStructure of GH136 lacto-N-biosidase from Eubacterium ramulus - native protein [Eubacterium ramulus ATCC 29099]
6KQS_A	1.29e-64	367	717	247	638	CrystalStructure of GH136 lacto-N-biosidase from Eubacterium ramulus - selenomethionine derivative [Eubacterium ramulus ATCC 29099]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0DTR4	1.21e-06	864	1085	438	644	A type blood N-acetyl-alpha-D-galactosamine deacetylase OS=Flavonifractor plautii OX=292800 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000446	0.998612	0.000306	0.000250	0.000189	0.000168

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001748_00606.