CAZyme Information: MGYG000001748_00631

Basic Information

• Species: CAG-56 sp900762665
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; CAG-56; CAG-56 sp900762665
• CAZyme ID: MGYG000001748_00631
• CAZy Family: GH146
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
914	MGYG000001748_5|CGC1	103486.73	5.0116

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001748	4218051	MAG	Sweden	Europe

• Gene Location: Start: 61262; End: 64006 Strand: +

Full Sequence      

MYQIKHKLYRAMVIVIVALSLNMSVMPQVLASGTGFGDSESRLEGGNCSMTRELEAVVSL
NRNFLEVYGIKADFQLCNKRTTDRNVFMVLSLYDSQGKLLRIHNQTLALPPNAAKQAALK
ISLSQEEVTKFKSAKAFVWDANTLRPLTSVVLKQDMFGDTVETLTKAAIFDGFDVGLKGD
SYFKEQLETGAKYLKYYEPDRLAASLYINNFPERSPAEPYGGWESGGLPGHSVGHYLSAC
VSMYMQTGDEDFRDRALRLIYLIGEAQYDDGYVGGVAKSKMDNVFNNPETFWAGGYNGAY
LDGMWAPWYSIHKIYGGLIDAYLYMGEERALEIAENMAKYAKRGTDKLSPARMDYMLDGE
YGGMNESFAQLYEITGKEDYLILAKRFSHKKVMDPLSRGEDNLSGLHANTQVPKMIGAAK
IYQLTGDEYYKNVAENFWKFVVYDRSYATGGHCDKEFFTEQGTEPRSVESTETCNVYNML
KLTEYLYSVDPKTEYIEFYENALYNHILGSQNPVGDKTYNIDLTMGGHKKYFEHFKDMTC
CEGTGMENPGRFYRMIYSHADNGIAVNLFIDSELQMKEKGIVLRQTTDFPYSDESTLKFE
QASGKNLPLKIRIPAWTKGAQIVVNGEKVNSQPGEDGYVTITKAWCTGDTVKLTLPMDYS
LYESREDQEGKIVAFKYGPILLAGEFEGNKVPYIITESRDPKEILTKTDESKLRFEIRDI
LQPGSKSISLKPFFEFVSEKYMVYWNLYTQKQYEESRGPEEIFQDQLDSATYDMVQPNDS
NSEAAHNLQVNGTTSSGMWQEKGWRDAAGPGSFCYDLKVKPTSVNYLLSVFYGNEYGNAG
IRTFDILVEGEVIGTYTLDRNRPNDPWEYHYLDIPSRLTDGKTKVTVTYRANEAGYTAGG
VFEVRTTSAKLWPY

Enzyme Prediction     

No EC number prediction in MGYG000001748_00631.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH146	179	683	1.1e-168	0.9900596421471173

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	5.32e-157	180	683	6	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	4.97e-119	190	686	26	504	Uncharacterized conserved protein, DUF1680 family [Function unknown].
pfam16375	DUF4986	1.56e-06	689	745	27	84	Domain of unknown function. This family around 150 residues locates in the C-terminal of some uncharacterized proteins in various Bacteroides and Bacillus species. The function of this family remains unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNF29693.1	8.50e-179	183	910	11	757
BAB05596.1	1.16e-171	200	905	31	754
AEP88543.1	1.98e-170	174	911	3	758
APH66456.1	1.10e-169	174	911	3	758
QAV10929.1	1.60e-169	174	910	3	757

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YQH_AAA	7.02e-113	162	830	20	733	ChainAAA, Acetyl-CoA carboxylase, biotin carboxylase [Bacteroides thetaiotaomicron VPI-5482]
5OPJ_A	8.45e-106	162	830	20	733	Beta-L-arabinofuranosidase[Bacteroides thetaiotaomicron]
4QJY_A	2.31e-24	233	685	79	562	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	6.64e-23	233	685	79	562	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000297	0.998940	0.000187	0.000218	0.000184	0.000169

TMHMM  Annotations     

start	end
13	35