CAZyme Information: MGYG000001748_01121

Basic Information

• Species: CAG-56 sp900762665
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; CAG-56; CAG-56 sp900762665
• CAZyme ID: MGYG000001748_01121
• CAZy Family: GH3
• CAZyme Description: Chromosome partition protein Smc

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1750	MGYG000001748_9|CGC2	193948.16	4.8031

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001748	4218051	MAG	Sweden	Europe

• Gene Location: Start: 108942; End: 114194 Strand: +

Full Sequence      

MLFVLTIVNTVTLPGNFMQVQAEELPGLGDAARKAASEGIVLLENQDQVLPLKEGEEVSV
FGRVQVDTFFCGYGSGGYVYPSQKVNILNGLRANPDVKVNEDLAHIYETWCKANPAKGND
AGWAKWPYYHPEMPLDDSKVAEASQRSQKAIVIIGRGAGEDRECKLEAGSYYLTNDEKKL
LSQVNENFEQVIVLLNIGNLIDMSWKNDYQNVKAVLNIWQGGMQTGKAVADILSGEVNPS
GKLASTIAKKYQDYPSSSNFGKSQYNNYAEDIFVGYRYFETFEDAKDKVMYPFGYGLSYT
DFQIDTLGVTSDEDQVQVTVNVTNTGERSGKEVVQIYYGAPQGTLGKAAKSLAAYAKTPL
LEPGTSQEMTLSFQISSMASYDDSGKTGHKSAFVLEAGEYPIYVGNSVRAARKEGTYIQQ
KLAVTEQLEEAAAPEQSFEIMTASEGSGGTIVRSTEPVSTRTVDLEKRIQDHLPDEIAYT
GNKGHQLLDVYQGKVTMDEFIAQMSEDDLARIARGAGGMQSSLGSGGNAGVFGGVETSLR
DLGIVPVSTHDGPSGLRLRDTDSSSLLPIGSLLACTWNNELVEYLYSLLGEEMIINGVDI
LLAPGMNLQRDPLCGRNFEYFSEDPLITGMMGAATTRGVQASGAGACLKHFAGNNQETNR
KKTDSRLSERALREIYLRGFEIAVKTSDPFTVMSGYNKLNGVWCCYNYELMTTILRDQWG
YNGMLMTDWSMQSAQSPFNENVKDNAYRVQAQLDLYMPGDFSNASIKNALGKGLTLGELQ
RSAKNILNCVLLTPKFARENALEYHQYAKPETYFQVTGGDKVDGESARLSSIEVGGRKLV
IFNPLVQEYSVFHKPSDPIPEITVTAPEGVDVQISQATNERPVAEVKAEENGVANIYRIT
FEYGMDMTPVVEDPVYAYLDNIYLDGEAIPGFYSSIYEYEVVTGTRPEITVAEKEGVETT
ITYLDDNSGAKVLAESAHHAVTYSITFAQGPQSDEFDGDTLKEFWTNHAPTSKAYVSDGA
LHIETEDGDLYQNVKDLKNYISQPAQGDWESVTKIQLDNMPSQIYHQIGVKIMQDEDNYL
YFRLEQLDKNAGIAVRLNEEKAAKSTEIVRNTTFAGSIKDNTYYMKVMKNGQTYNFYISA
DGENYVTIKEGYTVNYSQPKYTLVAANGTGKTDIPSIKTSYDYVRFTMKEEAAAKVVKVR
KDEQSRIKVAEDFFNKSSELKAESCSDEDGGLSMGYSAPGEWALYTIDIEETGYYNIRPR
ISSARDELYQLSFGLELDAKPLTTFMQLGGTGGWSSWKTMDAKQVYLEKGEHKLKLYYLS
DGININWLQFDYMKPHIISAQETEGAVVTVDKGQAVVGETISFTVTVNDSEKELGDINVI
AGINIITVKKRADGSYYFEMPDKDVLILTSVREKTRSEEEYQALLAELKKKEEELYTKES
ELAGKEKELKAALEQAAELSQKIQDKKEEVEKLTASLTEANGKIEELKNSSQNQEEKIQE
LEEKAAKLGAQLNAAQDEVHGLEDELAETQNRVNTLKEENENLKNEVAEAIAQTEQIKKE
AKTAKEELEQAKAEAEKAQKEAWEEAVKAKENADKANTELERLKASMTLKDGDLKNEEGV
RYRVTNAALGQAEAYAPVSKKARTIKIAADIEVKGIKCRVTAVSDRAFSNMTKLTKVTIG
KNVTSVGKKAFLGDKKLKKIYVKSKKLKKVEKQALKGISSKAVIEVPDSRKKAYKKIFKG
RGQKKSVKIK

Enzyme Prediction     

EC	3.2.1.21	3.2.1.58	3.2.1.37	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	541	758	6e-59	0.9722222222222222
CBM6	1209	1331	4.7e-20	0.8623188405797102

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1472	BglX	1.05e-53	551	800	67	322	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam01915	Glyco_hydro_3_C	1.20e-37	40	276	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
PRK15098	PRK15098	1.28e-36	31	409	386	756	beta-glucosidase BglX.
pfam00933	Glyco_hydro_3	5.46e-29	563	788	84	315	Glycosyl hydrolase family 3 N terminal domain.
cd04080	CBM6_cellulase-like	2.13e-28	1223	1330	39	143	Carbohydrate Binding Module 6 (CBM6); appended to glycoside hydrolase (GH) domains, including GH5 (cellulase). This family includes carbohydrate binding module 6 (CBM6) domains that are appended to several glycoside hydrolase (GH) domains, including GH5 (cellulase) and GH16, as well as to coagulation factor 5/8 carbohydrate-binding domains. CBM6s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. The CBM6s are appended to GHs that display a diversity of substrate specificities. For some members of this family information is available about the specific substrates of the appended GH domains. It includes the CBM domains of various enzymes involved in cell wall degradation including, an extracellular beta-1,3-glucanase from Lysobacter enzymogenes encoded by the gluC gene (its catalytic domain belongs to the GH16 family), the tandem CBM domains of Pseudomonas sp. PE2 beta-1,3(4)-glucanase A (its catalytic domain also belongs to GH16), and a family 6 CBM from Cellvibrio mixtus Endoglucanase 5A (CmCBM6) which binds to the beta1,4-beta1,3-mixed linked glucans lichenan, and barley beta-glucan, cello-oligosaccharides, insoluble forms of cellulose, the beta1,3-glucan laminarin, and xylooligosaccharides, and the CBM6 of Fibrobacter succinogenes S85 XynD xylanase, appended to a GH10 domain, and Cellvibrio japonicas Cel5G appended to a GH5 (cellulase) domain. GH5 (cellulase) family includes enzymes with several known activities such as endoglucanase, beta-mannanase, and xylanase, which are involved in the degradation of cellulose and xylans. GH16 family includes enzymes with lichenase, xyloglucan endotransglycosylase (XET), and beta-agarase activities. CBM6 is an unusual CBM as it represents a chimera of two distinct binding sites with different modes of binding: binding site I within the loop regions and binding site II on the concave face of the beta-sandwich fold. For CmCBM6 it has been shown that these two binding sites have different ligand specificities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANC30255.1	1.30e-257	27	797	46	820
AZS42860.1	7.31e-256	26	803	38	818
QKJ18913.1	1.97e-248	27	795	37	808
SCY66942.1	1.42e-247	26	791	38	806
APZ35313.1	7.32e-246	26	791	38	825

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5WUG_A	1.09e-239	25	799	33	828	Expression,characterization and crystal structure of a novel beta-glucosidase from Paenibacillus barengoltzii [Paenibacillus barengoltzii],5WVP_A Expression, characterization and crystal structure of a novel beta-glucosidase from Paenibacillus barengoltzii [Paenibacillus barengoltzii]
2X40_A	2.68e-60	497	796	4	310	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
2X42_A	2.85e-59	497	796	4	310	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]
7MS2_A	8.17e-53	542	801	35	297	ChainA, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	2.05e-47	520	827	17	312	CrystalStructure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P15885	2.78e-192	30	799	11	771	Beta-glucosidase OS=Ruminococcus albus OX=1264 PE=3 SV=1
P16084	1.86e-142	34	729	34	770	Beta-glucosidase A OS=Butyrivibrio fibrisolvens OX=831 GN=bglA PE=3 SV=1
P14002	4.47e-52	542	801	35	297	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2
E7CY69	8.76e-49	520	790	17	285	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium longum OX=216816 GN=apy PE=1 SV=1
F6C6C1	8.88e-48	520	790	17	285	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium breve (strain ACS-071-V-Sch8b) OX=866777 GN=HMPREF9228_1477 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.828409	0.170870	0.000444	0.000101	0.000078	0.000111

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001748_01121.