CAZyme Information: MGYG000001748_01164

Basic Information

• Species: CAG-56 sp900762665
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; CAG-56; CAG-56 sp900762665
• CAZyme ID: MGYG000001748_01164
• CAZy Family: GH43
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1095	MGYG000001748_10|CGC2	119952.34	6.865

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001748	4218051	MAG	Sweden	Europe

• Gene Location: Start: 65396; End: 68683 Strand: +

Full Sequence      

MKRKRSIPAFVLLLLLALGTLTMWPAAKAEAANPYLPLWEHMPDGEPRIFEDPDNPGKYR
VYVYGSHDTMRNHYCGLDIRAWSAPVEDLSDWRDEGSVFKYEVDGRWDIMYAPDIAEVIR
KDGTKDYYLYPHSRVGGKNGDDEQYDPGVNRVPMVCKGSSPVGPFEPINLDEDGINVVDG
SPLGFDPGVWIEYITDPADPDYEIGFRAYAYWGFGGTEEKSWACELDQNTMYSVRPGTEP
IHYFIPSNSYGYKDPPGTKYPYIYPDENPDDFNFFEASSIRKVGNKYVLIYSGMSGGEYG
VWTSNSTLRYAYGDSPLGPWRSGGVLVDSRAPVSNQNGDGIMLTGGHNNTHGSILEINGQ
WYVFYHRPPNGNGFARQAMVAPLKITWDEKSVEEGGKVVIRAYDPYNDENGNIWTAKGGS
HEYTGAEVTSEGFNMFGLDPYQYYSAGYACYITGNAAFEESYDIWDNHMTVKNVGNGAVI
GYKYFGFGGLEENTLGLKPFEGTEQGNQTKFNAFLIPKTSKAFKISVWMDGPWDNATWKG
TKLGEINVPAGSAQENTKFELDVSDIVDNLDEKHAIYLVAEGGNGNLFDLIGIGFSKDGK
ELSAPNVPEVSISVDGKPINLPGQPIASTTYNGIVDYGTYQYDHILPAGTTEIPVVTASA
SDDKVKITVSQAASVTGADSVAIVRFNYNGADKTYRIPFSEASKNYNVLMELPSDLKDLE
QAAKIIGDSVVVDVTESAAPQERADKALEVLTTDRRLQALNVEIQVACEGDDAYTVTLKK
GGTVMTIPAFSILDIEKHKVFLDVCGGVLEAPAAFTVKNGYPVGNLPRPVRSGHTFAGWY
TARTGGDRVDARTIVNGDAVYYARWIINSYTVNFDPNGGTLGAAEKTRQVNYGAAVGALP
VPSRSGYTFNGWYTAGTGGNAVSTAMMVESDITVYAQWTANPAAPDAGPKKGSFFNAKAF
KFKITKQAVGKKPGAVQVVKPLKKKLTSAVIPADVRSGSYKYYVESIGDRAFKKCRALKK
VTIGKNVVKIGKEAFSGDGKLKMIKIQTKKLKSVGKNAFKGIYKKARIKAPASKLKAYKK
LLKKKGQKATVKIVR

Enzyme Prediction     

No EC number prediction in MGYG000001748_01164.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH43	33	385	1.5e-101	0.9965986394557823

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd18620	GH43_XylA-like	2.85e-77	43	388	1	269	Glycosyl hydrolase family 43-like protein such as Clostridium stercorarium alpha-L-arabinofuranosidase XylA. This glycosyl hydrolase family 43 (GH43) subgroup belongs to the GH43_AXH-like subgroup which includes enzymes that have been characterized with beta-xylosidase (EC 3.2.1.37), alpha-L-arabinofuranosidase (EC 3.2.1.55), alpha-1,2-L-arabinofuranosidase 43A (arabinan-specific; EC 3.2.1.-), endo-alpha-L-arabinanase as well as arabinoxylan arabinofuranohydrolase (AXH) activities. GH43 are inverting enzymes (i.e. they invert the stereochemistry of the anomeric carbon atom of the substrate) that have an aspartate as the catalytic general base, a glutamate as the catalytic general acid and another aspartate that is responsible for pKa modulation and orienting the catalytic acid. Many GH43 enzymes display both alpha-L-arabinofuranosidase and beta-D-xylosidase activity using aryl-glycosides as substrates. The GH43_XylA-like subgroup includes Clostridium stercorarium alpha-L-arabinofuranosidase XylA, and enzymes that have been annotated as having beta-xylosidase (EC 3.2.1.37), alpha-L-arabinofuranosidase (EC 3.2.1.55), endo-alpha-L-arabinanase (EC 3.2.1.-) as well as arabinoxylan arabinofuranohydrolase (AXH) activities. GH43 are inverting enzymes (i.e. they invert the stereochemistry of the anomeric carbon atom of the substrate) that have an aspartate as the catalytic general base, a glutamate as the catalytic general acid and another aspartate that is responsible for pKa modulation and orienting the catalytic acid. Many GH43 enzymes display both alpha-L-arabinofuranosidase and beta-D-xylosidase activity using aryl-glycosides as substrates. AXHs specifically hydrolyze the glycosidic bond between arabinofuranosyl substituents and xylopyranosyl backbone residues of arabinoxylan.
cd08990	GH43_AXH_like	1.73e-35	44	388	2	264	Glycosyl hydrolase family 43 protein, includes arabinoxylan arabinofuranohydrolase, beta-xylosidase, endo-1,4-beta-xylanase, and alpha-L-arabinofuranosidase. This subgroup includes Bacillus subtilis arabinoxylan arabinofuranohydrolase (XynD;BsAXH-m23;BSU18160), Butyrivibrio proteoclasticus alpha-L-arabinofuranosidase (Xsa43E;bpr_I2319), Clostridium stercorarium alpha-L-arabinofuranosidase XylA, and metagenomic beta-xylosidase (EC 3.2.1.37) / alpha-L-arabinofuranosidase (EC 3.2.1.55) CoXyl43. It belongs to the glycosyl hydrolase clan F (according to carbohydrate-active enzymes database (CAZY)) which includes family 43 (GH43) and 62 (GH62) families. The GH43_AXH-like subgroup includes enzymes that have been characterized with beta-xylosidase, alpha-L-arabinofuranosidase, endo-alpha-L-arabinanase as well as arabinoxylan arabinofuranohydrolase (AXH) activities. GH43 are inverting enzymes (i.e. they invert the stereochemistry of the anomeric carbon atom of the substrate) that have an aspartate as the catalytic general base, a glutamate as the catalytic general acid and another aspartate that is responsible for pKa modulation and orienting the catalytic acid. Many GH43 enzymes display both alpha-L-arabinofuranosidase and beta-D-xylosidase activity using aryl-glycosides as substrates. AXHs specifically hydrolyze the glycosidic bond between arabinofuranosyl substituents and xylopyranosyl backbone residues of arabinoxylan. Metagenomic beta-xylosidase/alpha-L-arabinofuranosidase CoXyl43 shows synergy with Trichoderma reesei cellulases and promotes plant biomass saccharification by degrading xylo-oligosaccharides, such as xylobiose and xylotriose, into the monosaccharide xylose. Studies show that the hydrolytic activity of CoXyl43 is stimulated in the presence of calcium. Several of these enzymes also contain carbohydrate binding modules (CBMs) that bind cellulose or xylan. A common structural feature of GH43 enzymes is a 5-bladed beta-propeller domain that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.
cd09004	GH43_bXyl-like	1.16e-21	60	388	11	260	Glycosyl hydrolase family 43 protein such as Bacteroides thetaiotaomicron VPI-5482 alpha-L-arabinofuranosidases (BT3675;BT_3675) and (BT3662;BT_3662); includes mostly xylanases. This glycosyl hydrolase family 43 (GH43) subgroup includes enzymes that have been annotated as xylan-digesting beta-xylosidase (EC 3.2.1.37) and xylanase (endo-alpha-L-arabinanase, EC 3.2.1.8) activities, as well the Bacteroides thetaiotaomicron VPI-5482 alpha-L-arabinofuranosidases (EC 3.2.1.55) (BT3675;BT_3675) and (BT3662;BT_3662). It belongs to the glycosyl hydrolase clan F (according to carbohydrate-active enzymes database (CAZY)) which includes family 43 (GH43) and 62 (GH62) families. GH43 are inverting enzymes (i.e. they invert the stereochemistry of the anomeric carbon atom of the substrate) that have an aspartate as the catalytic general base, a glutamate as the catalytic general acid and another aspartate that is responsible for pKa modulation and orienting the catalytic acid. Many GH43 enzymes display both alpha-L-arabinofuranosidase and beta-D-xylosidase activity using aryl-glycosides as substrates. A common structural feature of GH43 enzymes is a 5-bladed beta-propeller domain that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.
cd18618	GH43_Xsa43E-like	6.12e-21	60	389	13	269	Glycosyl hydrolase family 43, including Butyrivibrio proteoclasticus arabinofuranosidase Xsa43E. This glycosyl hydrolase family 43 (GH43) subgroup belongs to the GH43_AXH-like subgroup which includes enzymes that have been characterized with beta-xylosidase (EC 3.2.1.37), alpha-L-arabinofuranosidase (EC 3.2.1.55), alpha-1,2-L-arabinofuranosidase 43A (arabinan-specific; EC 3.2.1.-), endo-alpha-L-arabinanase as well as arabinoxylan arabinofuranohydrolase (AXH) activities. GH43 are inverting enzymes (i.e. they invert the stereochemistry of the anomeric carbon atom of the substrate) that have an aspartate as the catalytic general base, a glutamate as the catalytic general acid and another aspartate that is responsible for pKa modulation and orienting the catalytic acid. Many GH43 enzymes display both alpha-L-arabinofuranosidase and beta-D-xylosidase activity using aryl-glycosides as substrates. AXHs specifically hydrolyze the glycosidic bond between arabinofuranosyl substituents and xylopyranosyl backbone residues of arabinoxylan. This subgroup includes Cellvibrio japonicus arabinan-specific alpha-1,2-arabinofuranosidase, CjAbf43A, which confers its specificity by a surface cleft that is complementary to the helical backbone of the polysaccharide, and Butyrivibrio proteoclasticus GH43 enzyme Xsa43E, also an arabinofuranosidase, which has been shown to cleave arabinose side chains from short segments of xylan. Several of these enzymes also contain carbohydrate binding modules (CBMs) that bind cellulose or xylan. A common structural feature of GH43 enzymes is a 5-bladed beta-propeller domain that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.
NF033189	internalin_A	9.72e-21	829	945	594	709	class 1 internalin InlA. Internalins, as found in the intracellular human pathogen Listeria monocytogenes, are paralogous surface or secreted proteins with an N-terminal signal peptide, leucine-rich repeats, and usually a C-terminal LPXTG processing and cell surface anchoring site. See PMID:17764999 for a general discussion of internalins. Members of this family are internalin A (InlA), a class 1 (LPXTG-type) internalin.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDO68312.1	1.21e-303	31	700	40	691
ALJ60075.1	2.77e-302	31	700	40	691
QUT88914.1	2.77e-302	31	700	40	691
QNL41333.1	1.26e-295	33	701	36	685
QUT44391.1	6.38e-294	11	700	22	703

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5A8C_A	3.93e-12	60	366	48	283	ChainA, CARBOHYDRATE BINDING FAMILY 6 [Acetivibrio thermocellus],5A8D_A Chain A, CARBOHYDRATE BINDING FAMILY 6 [Acetivibrio thermocellus]
4NOV_A	2.63e-11	61	389	66	328	Xsa43E,a GH43 family enzyme from Butyrivibrio proteoclasticus [Butyrivibrio proteoclasticus B316]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P48790	8.23e-41	28	388	2	312	Xylosidase/arabinosidase OS=Thermoclostridium stercorarium OX=1510 GN=xylA PE=1 SV=1
Q723K6	7.30e-17	829	945	595	710	Internalin A OS=Listeria monocytogenes serotype 4b (strain F2365) OX=265669 GN=inlA PE=3 SV=1
P0DJM0	1.66e-16	776	941	477	636	Internalin A OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) OX=169963 GN=inlA PE=1 SV=1
G2K3G6	2.18e-16	829	945	595	710	Internalin A OS=Listeria monocytogenes serotype 1/2a (strain 10403S) OX=393133 GN=inlA PE=3 SV=1
Q7AP87	1.62e-15	829	941	372	483	Internalin H OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) OX=169963 GN=inlH PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.002883	0.994113	0.001850	0.000573	0.000288	0.000250

TMHMM  Annotations     

start	end
7	26