CAZyme Information: MGYG000001748_02405

Basic Information

• Species: CAG-56 sp900762665
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; CAG-56; CAG-56 sp900762665
• CAZyme ID: MGYG000001748_02405
• CAZy Family: GH18
• CAZyme Description: Spore germination protein YaaH

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
380	MGYG000001748_28|CGC1	42734.73	4.366

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001748	4218051	MAG	Sweden	Europe

• Gene Location: Start: 34368; End: 35510 Strand: +

Full Sequence      

MEIYVVKPGDSVDTIAAAYGVLPESVIYNNQLIYPYRLAVGQALLLGEPESSQENRYIVA
NGYAYTYISPWVLQQTLPYLSELSVFSYGFSTGGYLIAPPMDDVWMVQAARQYNAVPVLT
LTPFGVDGKFNNRLISAVVNNPAAKEQLITQLLQVMGEKGYGGLDIDFEYILAEDRDAFT
QFVGEVTQRLNAYGYQVSVALAPKTSADQVGLLYEGKDYRGLGEAANQVLLMTYEWGYKY
GPNMAVAPINMVRRVLDYAVTEIEPAKISLGIPNYGYDWPLPFVRGETEAVTIGNVEAVQ
IAITNNAAIQFDQTAMSPFFRYILEGIEHEVWFEDVRSLQAKFALIREYGLRGCGYWQIM
RWFRANWMLLADTYRIEKNG

Enzyme Prediction     

No EC number prediction in MGYG000001748_02405.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	88	359	1.2e-37	0.8006756756756757

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd02874	GH18_CFLE_spore_hydrolase	5.19e-116	58	370	2	313	Cortical fragment-lytic enzyme (CFLE) is a peptidoglycan hydrolase involved in bacterial endospore germination. CFLE is expressed as an inactive preprotein (called SleB) in the forespore compartment of sporulating cells. SleB translocates across the forespore inner membrane and is deposited as a mature enzyme in the cortex layer of the spore. As part of a sensory mechanism capable of initiating germination, CFLE degrades a spore-specific peptidoglycan constituent called muramic-acid delta-lactam that comprises the outer cortex. CFLE has a C-terminal glycosyl hydrolase family 18 (GH18) catalytic domain as well as two N-terminal LysM peptidoglycan-binding domains. In addition to SleB, this family includes YaaH, YdhD, and YvbX from Bacillus subtilis.
COG3858	YaaH	2.00e-97	3	370	51	418	Spore germination protein YaaH [Cell cycle control, cell division, chromosome partitioning].
cd06549	GH18_trifunctional	9.38e-33	97	357	41	288	GH18 domain of an uncharacterized family of bacterial proteins, which share a common three-domain architecture: an N-terminal glycosyl hydrolase family 18 (GH18) domain, a glycosyl transferase family 2 domain, and a C-terminal polysaccharide deacetylase domain.
smart00636	Glyco_18	1.71e-25	80	359	23	331	Glyco_18 domain.
cd02875	GH18_chitobiase	4.89e-20	139	359	91	336	Chitobiase (also known as di-N-acetylchitobiase) is a lysosomal glycosidase that hydrolyzes the reducing-end N-acetylglucosamine from the chitobiose core of oligosaccharides during the ordered degradation of asparagine-linked glycoproteins in eukaryotes. Chitobiase can only do so if the asparagine that joins the oligosaccharide to protein is previously removed by a glycosylasparaginase. Chitobiase is therefore the final step in the lysosomal degradation of the protein/carbohydrate linkage component of asparagine-linked glycoproteins. The catalytic domain of chitobiase is an eight-stranded alpha/beta barrel fold similar to that of other family 18 glycosyl hydrolases such as hevamine and chitotriosidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QEK18230.1	2.68e-177	1	378	1	377
QYX28648.1	2.92e-175	1	376	1	377
QRO38545.1	3.92e-173	1	376	1	377
QBF75423.1	3.92e-173	1	376	1	377
QRV19273.1	5.77e-168	1	378	1	378

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4S3K_A	6.22e-76	2	378	5	431	ChainA, Spore germination protein YaaH [Priestia megaterium QM B1551]
4S3J_A	3.19e-75	1	380	3	431	Crystalstructure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876],4S3J_B Crystal structure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876],4S3J_C Crystal structure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876]
3CZ8_A	3.11e-64	78	359	31	308	ChainA, Putative sporulation-specific glycosylase ydhD [Bacillus subtilis subsp. subtilis str. 168],3CZ8_B Chain B, Putative sporulation-specific glycosylase ydhD [Bacillus subtilis subsp. subtilis str. 168]
5JH8_A	5.00e-23	126	353	70	293	Crystalstructure of chitinase from Chromobacterium violaceum ATCC 12472 [Chromobacterium violaceum ATCC 12472]
4WIW_A	2.77e-22	135	357	87	327	ChainA, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_B Chain B, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_C Chain C, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_D Chain D, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_E Chain E, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_F Chain F, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P37531	1.63e-84	1	378	1	427	Cortical fragment-lytic enzyme OS=Bacillus subtilis (strain 168) OX=224308 GN=sleL PE=1 SV=2
P0DPJ9	5.75e-75	1	380	2	430	Cortical fragment-lytic enzyme OS=Bacillus anthracis OX=1392 GN=sleL PE=2 SV=1
Q9K3E4	8.94e-74	1	380	2	430	Cortical fragment-lytic enzyme OS=Bacillus cereus OX=1396 GN=sleL PE=1 SV=1
O05495	3.07e-68	1	378	47	419	Putative sporulation-specific glycosylase YdhD OS=Bacillus subtilis (strain 168) OX=224308 GN=ydhD PE=1 SV=2
O32258	4.30e-27	130	353	101	322	Uncharacterized glycosylase YvbX OS=Bacillus subtilis (strain 168) OX=224308 GN=yvbX PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000063	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001748_02405.