CAZyme Information: MGYG000001750_02379

Basic Information

• Species: Phocaeicola ilei
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola ilei
• CAZyme ID: MGYG000001750_02379
• CAZy Family: GH105
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
689		77465.43	6.6459

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001750	2839699	MAG	Sweden	Europe

• Gene Location: Start: 815; End: 2884 Strand: -

Full Sequence      

MVNDSNTPLHLLQPDYKVGYGVTSVEEIKKDMDRVLKYLEENTPARVVDQRTGKVITDYA
GMDTNAQLERGAFRLASYEWGVTYSAMLAAADATGDEAYRKYVYDRFNFLAEVAPYFKQV
YEKYGTTDPQMLQILTPHALDDAGAVCAAMMKAQMKGKNLKLQALIDNYFNFIMYKEYRL
ADGTFARNRPYHNTLWLDDMFMGIPAVALMGRYASDNQQKYYQEAVRQVLQFAGRMFVPE
KGLFRHGWVEGMKDHPAFHWGRANGWAILTMCEVLDVLPENNPDREKIIGLLQAHVRGLA
ACQSKDGFWHQLLDRNDSYLETSATAIYVYCMAHAINKGWIDAMAYGPVVQLGWHAVASA
INAQGQVEGTCVGTGMGYDPSFYYYRPVNVYAAHGYGPVIWAGAEMINLLKNQHPRMNDS
AVHFYPTEQQTKNPIFFYSEPGNPREFVAGVSRINEKTPVVFLIGDSTVKCGNGDGNDGK
WGWGSFFQNYFDTSRITVENCALGGTSSRTYGNIGLWDRVLPAIRKGDYVLIDFGHNDGG
PLNTGRARASLKGTGDETQKVVMERDGSTEEVHTFGYYIRQYIRQAKAKGANVIVLSHTP
GNRWTGNKMNRCDQTYGKWSEEVARQENVPFIDLNDRTAIKFETMGKDKAASYYADSVHN
TQEGAVLNAESVVEGIRALDNCSLKDYLK

Enzyme Prediction     

EC	3.2.1.172

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	73	407	4.6e-92	0.9668674698795181
CE12	461	676	1e-53	0.9904761904761905

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	1.16e-96	78	410	29	343	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
cd01821	Rhamnogalacturan_acetylesterase_like	2.50e-65	459	676	1	198	Rhamnogalacturan_acetylesterase_like subgroup of SGNH-hydrolases. Rhamnogalacturan acetylesterase removes acetyl esters from rhamnogalacturonan substrates, and renders them susceptible to degradation by rhamnogalacturonases. Rhamnogalacturonans are highly branched regions in pectic polysaccharides, consisting of repeating -(1,2)-L-Rha-(1,4)-D-GalUA disaccharide units, with many rhamnose residues substituted by neutral oligosaccharides such as arabinans, galactans and arabinogalactans. Extracellular enzymes participating in the degradation of plant cell wall polymers, such as Rhamnogalacturonan acetylesterase, would typically be found in saprophytic and plant pathogenic fungi and bacteria.
COG4225	YesR	7.64e-47	78	410	36	357	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
COG2755	TesA	7.14e-18	457	679	7	211	Lysophospholipase L1 or related esterase [Amino acid transport and metabolism].
cd00229	SGNH_hydrolase	1.49e-10	461	665	1	177	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VTZ55484.1	0.0	1	689	28	716
QIK54909.1	0.0	2	688	29	713
QIK60340.1	0.0	2	688	29	713
SCD19753.1	0.0	2	688	30	713
ADQ18031.1	1.44e-317	2	689	21	701

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3K11_A	1.28e-228	1	436	5	440	Crystalstructure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]
1DEO_A	5.85e-31	461	688	3	223	RHAMNOGALACTURONANACETYLESTERASE FROM ASPERGILLUS ACULEATUS AT 1.55 A RESOLUTION WITH SO4 IN THE ACTIVE SITE [Aspergillus aculeatus],1DEX_A RHAMNOGALACTURONAN ACETYLESTERASE FROM ASPERGILLUS ACULEATUS AT 1.9 A RESOLUTION [Aspergillus aculeatus],1K7C_A Rhamnogalacturonan acetylesterase with seven N-linked carbohydrate residues distributed at two N-glycosylation sites refined at 1.12 A resolution [Aspergillus aculeatus],1PP4_A The crystal structure of rhamnogalacturonan acetylesterase in space group P3121 [Aspergillus aculeatus],1PP4_B The crystal structure of rhamnogalacturonan acetylesterase in space group P3121 [Aspergillus aculeatus]
3C1U_A	2.75e-30	461	688	3	223	ChainA, Rhamnogalacturonan acetylesterase [Aspergillus aculeatus]
3QWT_A	5.48e-27	192	388	163	359	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
3PMM_A	2.70e-25	192	388	164	360	ChainA, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5BAA2	9.20e-31	461	688	20	235	Rhamnogalacturonan acetylesterase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=AN2528 PE=1 SV=1
Q00017	4.90e-30	461	688	20	240	Rhamnogalacturonan acetylesterase OS=Aspergillus aculeatus OX=5053 GN=rha1 PE=1 SV=1
O34559	3.70e-22	179	412	124	370	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
O31528	3.08e-18	461	679	5	205	Probable rhamnogalacturonan acetylesterase YesY OS=Bacillus subtilis (strain 168) OX=224308 GN=yesY PE=1 SV=1
O31521	5.97e-18	128	374	61	303	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000047	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001750_02379.